DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment conv and LRRTM4

DIOPT Version :10

Sequence 1:NP_610948.2 Gene:conv / 36588 FlyBaseID:FBgn0261269 Length:1092 Species:Drosophila melanogaster
Sequence 2:NP_001317299.1 Gene:LRRTM4 / 80059 HGNCID:19411 Length:591 Species:Homo sapiens


Alignment Length:527 Identity:110/527 - (20%)
Similarity:205/527 - (38%) Gaps:174/527 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 KELVIDGHAFQQLPKDLFAGQEIANSLGIIRVTNGNLSDLPIETFQPLRKLKTLDLHGNQLENLK 214
            |.:..:.|||..:|:::..|.:                              .|.|..|.::.||
Human    44 KIVYCESHAFADIPENISGGSQ------------------------------GLSLRFNSIQKLK 78

  Fly   215 RNQFKNLRELEVLDISHNQIKKLEAQHIADLTKLGWCNVSHNALSELSRGTFARNSVLKVLHLSH 279
            .|||                        |.|.:|.|                        |:|.|
Human    79 SNQF------------------------AGLNQLIW------------------------LYLDH 95

  Fly   280 NQIARLDANSFRGMRFLRRLFLSDNVLTDIGRGTFGSIARIGTIDLARNRLKKIEFQMFTQMNYV 344
            |.|:.:|.::|:|:|.|:.|.||.|.:|.:...||..:..:..:||:.|:|:.::.:.|      
Human    96 NYISSVDEDAFQGIRRLKELILSSNKITYLHNKTFHPVPNLRNLDLSYNKLQTLQSEQF------ 154

  Fly   345 ELLDLAENNITKIEKNSFKDIYQAIINVSHNALELIETAAFENCVNITVLDLSHNRLANFSRRSF 409
                   ..:.|:          .|:::..|:|:.:....|::|.|:..|||.:|||.:.||.:|
Human   155 -------KGLRKL----------IILHLRSNSLKTVPIRVFQDCRNLDFLDLGYNRLRSLSRNAF 202

  Fly   410 DETTFATYFQLSYNNLTNLAQIPIQNMTGLKVLNASYNSITEIPKNCFPKLYELHTIDVSHNNIS 474
                                    ..:..||.|:..:|..::|....||:|:.|.:|.:..|.|.
Human   203 ------------------------AGLLKLKELHLEHNQFSKINFAHFPRLFNLRSIYLQWNRIR 243

  Fly   475 SIFNGVFQTLFSLRSIDLSHNSMREIKSSTFGTLPTLLEMDLSHNELVSVVRGSLAKLTSLRQLY 539
            ||..|:..|..||.::|||.|.::.|:..||..||.|.:::|..|:|.::.:.::....||..:.
Human   244 SISQGLTWTWSSLHNLDLSGNDIQGIEPGTFKCLPNLQKLNLDSNKLTNISQETVNAWISLISIT 308

  Fly   540 LNNNQLEKLFQLPISLNELYFSHNRLTNIPSGTWPVMNSLIYLDLSHNQLGDTLNGESFTGLLVV 604
            |:.|    :::...|:..|::            | :.|               ..|...:.::..
Human   309 LSGN----MWECSRSICPLFY------------W-LKN---------------FKGNKESTMICA 341

  Fly   605 QRLKLQNNGISQPPKDAVA---VMSTLQYLHLENNNIT--TLERSAFGKLPVLFELNLYGNQVKD 664
            ....:|...:|    |||.   :.|.:|.::.|.:::.  |.::......|.:|:        .|
Human   342 GPKHIQGEKVS----DAVETYNICSEVQVVNTERSHLVPQTPQKPLIIPRPTIFK--------PD 394

  Fly   665 ISKRAFE 671
            :::..||
Human   395 VTQSTFE 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
convNP_610948.2 leucine-rich repeat 125..148 CDD:275380
leucine-rich repeat 150..175 CDD:275380 6/24 (25%)
leucine-rich repeat 176..199 CDD:275380 0/22 (0%)
PPP1R42 191..359 CDD:455733 35/167 (21%)
LRR_8 198..258 CDD:404697 12/59 (20%)
leucine-rich repeat 200..223 CDD:275380 8/22 (36%)
leucine-rich repeat 224..271 CDD:275380 4/46 (9%)
leucine-rich repeat 272..295 CDD:275380 8/22 (36%)
leucine-rich repeat 296..319 CDD:275380 8/22 (36%)
leucine-rich repeat 322..343 CDD:275380 5/20 (25%)
leucine-rich repeat 344..367 CDD:275380 1/22 (5%)
LRR 346..718 CDD:443914 70/331 (21%)
leucine-rich repeat 371..390 CDD:275380 4/18 (22%)
leucine-rich repeat 391..414 CDD:275380 9/22 (41%)
leucine-rich repeat 416..438 CDD:275380 0/21 (0%)
leucine-rich repeat 439..462 CDD:275380 8/22 (36%)
leucine-rich repeat 463..486 CDD:275380 8/22 (36%)
leucine-rich repeat 487..510 CDD:275380 9/22 (41%)
leucine-rich repeat 511..534 CDD:275380 4/22 (18%)
leucine-rich repeat 535..554 CDD:275380 3/18 (17%)
leucine-rich repeat 555..578 CDD:275380 2/22 (9%)
leucine-rich repeat 579..603 CDD:275380 1/23 (4%)
leucine-rich repeat 604..627 CDD:275380 5/25 (20%)
leucine-rich repeat 628..649 CDD:275380 3/22 (14%)
PPP1R42 631..849 CDD:455733 7/43 (16%)
leucine-rich repeat 652..672 CDD:275380 4/20 (20%)
leucine-rich repeat 700..726 CDD:275380
leucine-rich repeat 727..745 CDD:275380
leucine-rich repeat 779..802 CDD:275380
leucine-rich repeat 829..852 CDD:275380
LRRTM4NP_001317299.1 leucine-rich repeat 44..62 CDD:275380 5/17 (29%)
leucine-rich repeat 65..87 CDD:275380 10/75 (13%)
LRR 67..>312 CDD:443914 84/339 (25%)
leucine-rich repeat 88..111 CDD:275380 10/46 (22%)
leucine-rich repeat 112..135 CDD:275380 8/22 (36%)
leucine-rich repeat 136..159 CDD:275380 5/35 (14%)
leucine-rich repeat 160..183 CDD:275380 5/32 (16%)
leucine-rich repeat 184..207 CDD:275380 9/46 (20%)
leucine-rich repeat 208..231 CDD:275380 8/22 (36%)
leucine-rich repeat 232..255 CDD:275380 8/22 (36%)
leucine-rich repeat 256..279 CDD:275380 9/22 (41%)
leucine-rich repeat 304..316 CDD:275378 3/15 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.