DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment conv and Lrrc17

DIOPT Version :10

Sequence 1:NP_610948.2 Gene:conv / 36588 FlyBaseID:FBgn0261269 Length:1092 Species:Drosophila melanogaster
Sequence 2:NP_001020326.1 Gene:Lrrc17 / 502715 RGDID:1560165 Length:446 Species:Rattus norvegicus


Alignment Length:443 Identity:101/443 - (22%)
Similarity:165/443 - (37%) Gaps:160/443 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   325 LARNRLKKIEFQMFTQMNYVELLDLAENNITKIEKNSFKDIYQAIINVSHNALELIETAAFENCV 389
            ||||:::.::..||::...::.|||.:|.|:|||..:|..:.:                      
  Rat    93 LARNKIRVLKNNMFSKFKRLKSLDLQQNEISKIESEAFFGLNK---------------------- 135

  Fly   390 NITVLDLSHNRLANFSRRSFDETTFATYFQLSYNNLTNLAQIPIQNMTGLKVLNASYNSITEIPK 454
             :|.|.|.||::...:...|..|...:|.:| |:|                            |.
  Rat   136 -LTTLLLQHNQIKVLTEEVFIYTPLLSYLRL-YDN----------------------------PW 170

  Fly   455 NCFPKLYELHTIDVSHNNISSIFNGVFQTLFSLRSIDLSHNSMREIKSSTFGTLPTLLEMDLSHN 519
            :|..:|                     :||.|:..|..:.|.....|.   |:.|.|      .|
  Rat   171 HCACEL---------------------ETLVSMLQIPRNRNLGNYAKC---GSPPAL------RN 205

  Fly   520 ELVSVVRGSLAKLTSLR-QLYLNNNQLEKLFQLPISLNELYFSHNRLTNIPSGTWPVMNSLIYLD 583
            :          ||..|: |...:..:.|:|..:|           :::.:|:...|..:|    .
  Rat   206 K----------KLLQLKPQELCDEEEKERLDPIP-----------QVSGVPAVIRPEADS----T 245

  Fly   584 LSHNQLGDTLNGESFTGLLVVQRLKLQNNGISQPPKDAVAVMSTLQYLHLENNNITTLERSAFGK 648
            |.||.            :..:|.|..:...:.:.|                 |||.         
  Rat   246 LCHNY------------VFPIQTLDCKRKELKKVP-----------------NNIP--------- 272

  Fly   649 LPVLFELNLYGNQVKDISKRAFEGLLQLLTLNLSSNGIQTLQNDIFVGLPSLRNLDLSFNSLTKL 713
             |.:.:|:|..|::..:..:.||.:.:|..|||||||::.:....|:||..|..||||.|||...
  Rat   273 -PNIVKLDLSYNKISQLRPKEFEDVHELKKLNLSSNGLEFIDPAAFLGLIHLEELDLSNNSLQSF 336

  Fly   714 DNKTNGVLDDLLSLETLDLSHN--RISFVTKKTFPSHQYIPYNLR-NLNLSYN 763
            |   .|||:||..|:.|.|..|  |..:       |..|:.|.|: :.|:.||
  Rat   337 D---YGVLEDLYFLKLLWLRDNPWRCDY-------SIHYLYYWLKHHYNVHYN 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
convNP_610948.2 leucine-rich repeat 125..148 CDD:275380
leucine-rich repeat 150..175 CDD:275380
leucine-rich repeat 176..199 CDD:275380
PPP1R42 191..359 CDD:455733 13/33 (39%)
LRR_8 198..258 CDD:404697
leucine-rich repeat 200..223 CDD:275380
leucine-rich repeat 224..271 CDD:275380
leucine-rich repeat 272..295 CDD:275380
leucine-rich repeat 296..319 CDD:275380
leucine-rich repeat 322..343 CDD:275380 6/17 (35%)
leucine-rich repeat 344..367 CDD:275380 9/22 (41%)
LRR 346..718 CDD:443914 78/372 (21%)
leucine-rich repeat 371..390 CDD:275380 0/18 (0%)
leucine-rich repeat 391..414 CDD:275380 7/22 (32%)
leucine-rich repeat 416..438 CDD:275380 4/21 (19%)
leucine-rich repeat 439..462 CDD:275380 3/22 (14%)
leucine-rich repeat 463..486 CDD:275380 2/22 (9%)
leucine-rich repeat 487..510 CDD:275380 4/22 (18%)
leucine-rich repeat 511..534 CDD:275380 4/22 (18%)
leucine-rich repeat 535..554 CDD:275380 5/19 (26%)
leucine-rich repeat 555..578 CDD:275380 2/22 (9%)
leucine-rich repeat 579..603 CDD:275380 3/23 (13%)
leucine-rich repeat 604..627 CDD:275380 3/22 (14%)
leucine-rich repeat 628..649 CDD:275380 3/20 (15%)
PPP1R42 631..849 CDD:455733 46/136 (34%)
leucine-rich repeat 652..672 CDD:275380 4/19 (21%)
leucine-rich repeat 700..726 CDD:275380 14/25 (56%)
leucine-rich repeat 727..745 CDD:275380 5/19 (26%)
leucine-rich repeat 779..802 CDD:275380
leucine-rich repeat 829..852 CDD:275380
Lrrc17NP_001020326.1 leucine-rich repeat 68..86 CDD:275380
LRR <89..>356 CDD:443914 92/411 (22%)
leucine-rich repeat 89..111 CDD:275380 6/17 (35%)
leucine-rich repeat 112..135 CDD:275380 9/22 (41%)
leucine-rich repeat 136..159 CDD:275380 7/22 (32%)
PCC 141..>247 CDD:188093 32/189 (17%)
leucine-rich repeat 160..210 CDD:275380 19/118 (16%)
leucine-rich repeat 211..274 CDD:275380 17/116 (15%)
leucine-rich repeat 275..298 CDD:275380 5/22 (23%)
leucine-rich repeat 299..322 CDD:275380 11/22 (50%)
leucine-rich repeat 323..346 CDD:275380 14/25 (56%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.