DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment conv and alrm

DIOPT Version :9

Sequence 1:NP_001286416.1 Gene:conv / 36588 FlyBaseID:FBgn0261269 Length:1092 Species:Drosophila melanogaster
Sequence 2:NP_651393.1 Gene:alrm / 43074 FlyBaseID:FBgn0039332 Length:471 Species:Drosophila melanogaster


Alignment Length:475 Identity:110/475 - (23%)
Similarity:182/475 - (38%) Gaps:112/475 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 DYVFYG---VNNTLEQLHLLRTNLSHVGLLGFGILGKAKELVIDGHAFQQLPKDLFAGQEIANSL 176
            |||...   :..| ..|..|.::::.:..|.|......:.|.::..:.:...|..|.|   |::|
  Fly    55 DYVILSQAPIGGT-TMLTFLNSSIAKIPHLLFDTFPDLQVLRMENCSLETFEKPQFEG---ASNL 115

  Fly   177 GIIRVTNGNLSDLPIETFQPLRKLKTLDLHGNQLENLKRNQFKNLRELEVLDISHNQIKKLEAQH 241
            ..:.:....|.|:|...|.....|.||.|.||||:.|..:.|..|:|::.|.::.||::::....
  Fly   116 MSLFLGYNRLKDIPKNIFLGADNLATLHLQGNQLKQLGNHSFHALKEVKELSLAENQLEQISLGV 180

  Fly   242 IADLTKLGWCNVSHNALSELSRGTFARNSVLKVLHLSHNQIARLDANSFRGMRFLRRLFLSDNVL 306
            .:.:.||...|::.|.|..|.||.|.||..|..|:|:.|:....::...:......:|.:|.|:.
  Fly   181 FSGMRKLMDLNLAGNRLDALPRGVFDRNLNLTKLNLARNRFTAFESELLKLQPVFTQLDISGNIF 245

  Fly   307 TDIGRG-TFGSIARIGTIDLARNRLKKIEFQMFTQMNYVELLDLAENNITKIEKNSFKDIYQAII 370
            .::... |...:|...:.||.|          .|....:..|||..|::.::..           
  Fly   246 QELTLNFTMLDVAIAHSCDLRR----------LTVYGVIHELDLHNNSLREMPH----------- 289

  Fly   371 NVSHNALELIETAAFENCVNITVLDLSHNRLANFSRRSFDETTFATYFQLSYNNLTNLAQIPIQN 435
                     |..||     |::.||||||.|.                        ||...|::.
  Fly   290 ---------IPLAA-----NVSSLDLSHNPLG------------------------NLQGNPLRR 316

  Fly   436 MTGLKVLNASYNSITEIPKNCFPKLYELHTIDVSHNNISSIFNGVFQTLFSLRSIDLSHNSMR-- 498
            .|.|..||.|.....|:|:..|.|...|..:|:|.|:|.|:...:|.:|.:|:......|:..  
  Fly   317 FTSLLRLNLSATGAHELPEGLFKKQSHLQMLDISGNSIYSLKITIFDSLKALQYFYFQQNNWNCD 381

  Fly   499 --EIKSSTFGTLPTLLEM-DLSHNELV-------------------------------SVVRGSL 529
              ::..|:|.....:..| |::..|||                               ||||..:
  Fly   382 FLQLLMSSFVKRKDISFMEDITAPELVDDYVDGIACWYESDKQSKKCESGGSDAAMELSVVRNEI 446

  Fly   530 AKLTSLRQLYLNNNQLEKLF 549
            ...|.|         :||.|
  Fly   447 KTFTEL---------VEKKF 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
convNP_001286416.1 leucine-rich repeat 125..148 CDD:275380 4/22 (18%)
leucine-rich repeat 150..175 CDD:275380 5/24 (21%)
leucine-rich repeat 176..199 CDD:275380 5/22 (23%)
LRR_8 198..258 CDD:290566 19/59 (32%)
leucine-rich repeat 200..223 CDD:275380 11/22 (50%)
LRR_RI 201..545 CDD:238064 88/380 (23%)
leucine-rich repeat 224..271 CDD:275380 14/46 (30%)
LRR_8 245..306 CDD:290566 18/60 (30%)
leucine-rich repeat 272..295 CDD:275380 4/22 (18%)
LRR_8 296..354 CDD:290566 13/58 (22%)
leucine-rich repeat 296..319 CDD:275380 4/23 (17%)
LRR_8 322..401 CDD:290566 18/78 (23%)
leucine-rich repeat 322..343 CDD:275380 4/20 (20%)
leucine-rich repeat 344..367 CDD:275380 4/22 (18%)
leucine-rich repeat 371..390 CDD:275380 3/18 (17%)
leucine-rich repeat 391..414 CDD:275380 7/22 (32%)
leucine-rich repeat 416..438 CDD:275380 3/21 (14%)
LRR_8 437..495 CDD:290566 18/57 (32%)
leucine-rich repeat 439..462 CDD:275380 8/22 (36%)
leucine-rich repeat 463..486 CDD:275380 8/22 (36%)
LRR_RI 486..738 CDD:238064 18/100 (18%)
LRR_8 486..545 CDD:290566 15/94 (16%)
leucine-rich repeat 487..510 CDD:275380 4/26 (15%)
leucine-rich repeat 511..534 CDD:275380 9/54 (17%)
leucine-rich repeat 535..554 CDD:275380 4/15 (27%)
LRR_8 554..614 CDD:290566
leucine-rich repeat 555..578 CDD:275380
leucine-rich repeat 579..603 CDD:275380
leucine-rich repeat 604..627 CDD:275380
LRR_8 626..710 CDD:290566
leucine-rich repeat 628..649 CDD:275380
leucine-rich repeat 652..672 CDD:275380
LRR_8 698..765 CDD:290566
leucine-rich repeat 700..726 CDD:275380
leucine-rich repeat 727..745 CDD:275380
LRR_8 777..839 CDD:290566
leucine-rich repeat 779..802 CDD:275380
leucine-rich repeat 829..852 CDD:275380
alrmNP_651393.1 LRR_RI 84..354 CDD:238064 81/331 (24%)
LRR_8 91..149 CDD:290566 16/60 (27%)
leucine-rich repeat 91..114 CDD:275380 5/25 (20%)
leucine-rich repeat 115..138 CDD:275380 5/22 (23%)
LRR_8 138..197 CDD:290566 19/58 (33%)
leucine-rich repeat 139..162 CDD:275380 11/22 (50%)
leucine-rich repeat 163..186 CDD:275380 3/22 (14%)
LRR_8 185..243 CDD:290566 17/57 (30%)
leucine-rich repeat 187..210 CDD:275380 10/22 (45%)
leucine-rich repeat 211..283 CDD:275380 16/81 (20%)
leucine-rich repeat 284..319 CDD:275380 14/83 (17%)
LRR_8 318..377 CDD:290566 18/58 (31%)
leucine-rich repeat 320..343 CDD:275380 8/22 (36%)
leucine-rich repeat 344..365 CDD:275380 7/20 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45617
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.