DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment conv and CG5810

DIOPT Version :9

Sequence 1:NP_001286416.1 Gene:conv / 36588 FlyBaseID:FBgn0261269 Length:1092 Species:Drosophila melanogaster
Sequence 2:NP_650952.2 Gene:CG5810 / 42513 FlyBaseID:FBgn0038866 Length:428 Species:Drosophila melanogaster


Alignment Length:370 Identity:92/370 - (24%)
Similarity:167/370 - (45%) Gaps:45/370 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 LRKLKTLDLHGNQLENLKRNQFKNLRELEVLDISHNQIKKLEAQHIADLTKLGWCNVSHNALSEL 261
            |||.:||.||.:.|.||.|..|.||.:|....:...:::::|:........|...|...|||..|
  Fly    62 LRKYETLVLHSSDLANLPRKIFLNLPQLVEFHVLECELQQIESVCFDGAKNLKRLNFGGNALRVL 126

  Fly   262 SRGTFARNSVLKVLHLSHNQIARLDANSFRGMRFLRRLFLSDNVLTDIGRGTFGSIARIGTIDLA 326
            ...||...:.|:.|:||.||:..|....||.::.|:::.||:|.|..:.:..|..:..:.:|::.
  Fly   127 DSNTFELATQLEELNLSDNQLEDLPTTIFRPLKNLQKINLSNNRLITLSQHIFSQLGSLKSINVD 191

  Fly   327 RNRLKKIEFQMF-TQMNYVELLDLAENNITKIEKNSFKDIYQAIINVS------HNALELIETAA 384
            .|:|.::..::| .|..::.......|.:.:|..|.|::|....::.:      |.:.::.|..|
  Fly   192 SNQLVELPGELFRDQRKHLSEFSAQSNQLVRIPFNIFREIDHLSLSFNPQLRRLHLSAKINELEA 256

  Fly   385 FENC-----------VNITV--------------LDLSHNRLANFSRRSFDETTFAT-YFQLSYN 423
             .||           :.:.:              .||.|..|||.:....|..:.|: ...|...
  Fly   257 -TNCDLESVELDGRVIGVQLEANPKLHELKISQPQDLEHLYLANTNLYRLDFLSKASKLVDLDVT 320

  Fly   424 NLTNLAQIP-IQNMTGLKVLNASYNSITEIPKNCFPKLYELHTIDVSHNNISSIFNGVFQTLFSL 487
            ::.|||.:| |.:..||:.|:.:|:::|....:..|.|.:|:.:::||.....||.......|.:
  Fly   321 DIVNLADLPKITSAKGLERLSFTYDNLTSNHMDMLPHLKDLNYLEISHEKGKEIFIKDLDEDFFV 385

  Fly   488 RSIDLSHNSMREIKSSTFGTLP---TLLEMDLSHNELVSVVRGSL 529
            ...:|:...:.::..  |..||   |:||     :.||...||.:
  Fly   386 EEAELNCGQLADLLE--FVELPKDTTILE-----DRLVGDPRGPM 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
convNP_001286416.1 leucine-rich repeat 125..148 CDD:275380
leucine-rich repeat 150..175 CDD:275380
leucine-rich repeat 176..199 CDD:275380 1/1 (100%)
LRR_8 198..258 CDD:290566 18/59 (31%)
leucine-rich repeat 200..223 CDD:275380 11/22 (50%)
LRR_RI 201..545 CDD:238064 89/366 (24%)
leucine-rich repeat 224..271 CDD:275380 10/46 (22%)
LRR_8 245..306 CDD:290566 21/60 (35%)
leucine-rich repeat 272..295 CDD:275380 9/22 (41%)
LRR_8 296..354 CDD:290566 12/58 (21%)
leucine-rich repeat 296..319 CDD:275380 6/22 (27%)
LRR_8 322..401 CDD:290566 18/110 (16%)
leucine-rich repeat 322..343 CDD:275380 5/21 (24%)
leucine-rich repeat 344..367 CDD:275380 5/22 (23%)
leucine-rich repeat 371..390 CDD:275380 5/35 (14%)
leucine-rich repeat 391..414 CDD:275380 7/36 (19%)
leucine-rich repeat 416..438 CDD:275380 6/23 (26%)
LRR_8 437..495 CDD:290566 14/57 (25%)
leucine-rich repeat 439..462 CDD:275380 6/22 (27%)
leucine-rich repeat 463..486 CDD:275380 5/22 (23%)
LRR_RI 486..738 CDD:238064 11/47 (23%)
LRR_8 486..545 CDD:290566 11/47 (23%)
leucine-rich repeat 487..510 CDD:275380 4/25 (16%)
leucine-rich repeat 511..534 CDD:275380 6/19 (32%)
leucine-rich repeat 535..554 CDD:275380
LRR_8 554..614 CDD:290566
leucine-rich repeat 555..578 CDD:275380
leucine-rich repeat 579..603 CDD:275380
leucine-rich repeat 604..627 CDD:275380
LRR_8 626..710 CDD:290566
leucine-rich repeat 628..649 CDD:275380
leucine-rich repeat 652..672 CDD:275380
LRR_8 698..765 CDD:290566
leucine-rich repeat 700..726 CDD:275380
leucine-rich repeat 727..745 CDD:275380
LRR_8 777..839 CDD:290566
leucine-rich repeat 779..802 CDD:275380
leucine-rich repeat 829..852 CDD:275380
CG5810NP_650952.2 leucine-rich repeat 65..88 CDD:275380 11/22 (50%)
LRR_8 87..147 CDD:290566 15/59 (25%)
leucine-rich repeat 89..112 CDD:275380 2/22 (9%)
leucine-rich repeat 113..136 CDD:275380 8/22 (36%)
LRR_8 135..195 CDD:290566 17/59 (29%)
LRR_4 135..175 CDD:289563 14/39 (36%)
leucine-rich repeat 137..160 CDD:275380 9/22 (41%)
leucine-rich repeat 161..184 CDD:275380 6/22 (27%)
leucine-rich repeat 185..209 CDD:275380 5/23 (22%)
leucine-rich repeat 210..231 CDD:275380 4/20 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45617
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.