DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment conv and caps

DIOPT Version :9

Sequence 1:NP_001286416.1 Gene:conv / 36588 FlyBaseID:FBgn0261269 Length:1092 Species:Drosophila melanogaster
Sequence 2:NP_001303391.1 Gene:caps / 39493 FlyBaseID:FBgn0023095 Length:811 Species:Drosophila melanogaster


Alignment Length:433 Identity:123/433 - (28%)
Similarity:190/433 - (43%) Gaps:77/433 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   369 IINVSHNALELIETAAFENCVN--ITVLDLSHNRLANFSRRSFDETTFATYFQLSYNNLTNLAQI 431
            ::|.....|:::..|     :|  |..|.:.:|:|...      :::...|.||::         
  Fly    55 MVNCGEGTLDVLPIA-----LNPAIQRLVIKNNKLKTI------DSSMQFYAQLTF--------- 99

  Fly   432 PIQNMTGLKVLNASYNSITEIPKNCF---PKLYELHTIDVSHNNISSIFNGVFQTLFSLRSIDLS 493
                      |:.|:|.:..||:..|   .||.|||   :.||.|..:.|..|..|.::..::|.
  Fly   100 ----------LDLSFNDMLTIPERSFAYHAKLQELH---LDHNKIGQVSNKTFLGLSTISVLNLR 151

  Fly   494 HNSMREIKSSTFGTLPTLLEMDLSHNELVSVVRGSLAKLTSLRQLYLNNNQL-----EKLFQLPI 553
            .|.:.|::..||..:..|.|::|..|.:..:...:|..|.:||.|||::|.|     |..||...
  Fly   152 GNLIAELEYRTFSPMVKLAELNLGQNRISHIDPHALDGLDNLRVLYLDDNTLTTVPGELTFQALH 216

  Fly   554 SLNELYFSHNRLTNIPSGTWPVMNSLIYLDLS----HNQLGDTLNGESFTGLLVVQRLKLQNNGI 614
            ||.|||...|....||.|.:..:..|..|||.    ||     ::|::..||:.::.|.|.:|.:
  Fly   217 SLAELYLGTNSFMTIPGGAFQDLKGLTRLDLRGAGLHN-----ISGDALKGLVSLRFLDLSDNRL 276

  Fly   615 SQPPKDAVAVMSTLQYLHLENNNITTLERSAFGKLPVLFELNLYGNQ-VKDISKRAFEGLLQLLT 678
            ...|..|...:..|:.|::..|:...:...||..|..|..|.|.|.| ::.:...||.|...|..
  Fly   277 PAIPTAAFQRLGRLEQLNIGQNDFEVISSGAFSGLRELRHLELTGAQRLRRVESGAFSGNTNLEH 341

  Fly   679 LNLSSN-GIQTLQNDIFVGLPSLRNLDLSFNSLTKLDNKTNGVLDDLLSLETLDLSHN------- 735
            |||||| .:..|.:....|||.|..:.|..|.|:.||..    |.....|:|||||.|       
  Fly   342 LNLSSNKQLNELSSIALGGLPHLSTVVLKANQLSSLDEG----LVPWADLQTLDLSENPFECDCR 402

  Fly   736 ----RISFVTKKTFPSHQYIPY------NLRNLNLSYNLMPIL 768
                |...|::..  |.||.|.      .||:|.|::...|:|
  Fly   403 LLWLRHLLVSRNA--SGQYAPVICAYPTALRDLPLAHLAEPLL 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
convNP_001286416.1 leucine-rich repeat 125..148 CDD:275380
leucine-rich repeat 150..175 CDD:275380
leucine-rich repeat 176..199 CDD:275380
LRR_8 198..258 CDD:290566
leucine-rich repeat 200..223 CDD:275380
LRR_RI 201..545 CDD:238064 45/180 (25%)
leucine-rich repeat 224..271 CDD:275380
LRR_8 245..306 CDD:290566
leucine-rich repeat 272..295 CDD:275380
LRR_8 296..354 CDD:290566
leucine-rich repeat 296..319 CDD:275380
LRR_8 322..401 CDD:290566 7/33 (21%)
leucine-rich repeat 322..343 CDD:275380
leucine-rich repeat 344..367 CDD:275380
leucine-rich repeat 371..390 CDD:275380 3/18 (17%)
leucine-rich repeat 391..414 CDD:275380 4/22 (18%)
leucine-rich repeat 416..438 CDD:275380 3/21 (14%)
LRR_8 437..495 CDD:290566 18/60 (30%)
leucine-rich repeat 439..462 CDD:275380 8/25 (32%)
leucine-rich repeat 463..486 CDD:275380 8/22 (36%)
LRR_RI 486..738 CDD:238064 84/273 (31%)
LRR_8 486..545 CDD:290566 17/58 (29%)
leucine-rich repeat 487..510 CDD:275380 5/22 (23%)
leucine-rich repeat 511..534 CDD:275380 6/22 (27%)
leucine-rich repeat 535..554 CDD:275380 10/23 (43%)
LRR_8 554..614 CDD:290566 21/63 (33%)
leucine-rich repeat 555..578 CDD:275380 8/22 (36%)
leucine-rich repeat 579..603 CDD:275380 9/27 (33%)
leucine-rich repeat 604..627 CDD:275380 5/22 (23%)
LRR_8 626..710 CDD:290566 28/85 (33%)
leucine-rich repeat 628..649 CDD:275380 5/20 (25%)
leucine-rich repeat 652..672 CDD:275380 7/20 (35%)
LRR_8 698..765 CDD:290566 25/83 (30%)
leucine-rich repeat 700..726 CDD:275380 7/25 (28%)
leucine-rich repeat 727..745 CDD:275380 9/28 (32%)
LRR_8 777..839 CDD:290566
leucine-rich repeat 779..802 CDD:275380
leucine-rich repeat 829..852 CDD:275380
capsNP_001303391.1 leucine-rich repeat 75..96 CDD:275380 4/26 (15%)
LRR_8 96..155 CDD:290566 21/80 (26%)
leucine-rich repeat 97..120 CDD:275380 7/41 (17%)
leucine-rich repeat 121..144 CDD:275380 10/25 (40%)
LRR_8 143..201 CDD:290566 16/57 (28%)
leucine-rich repeat 145..168 CDD:275380 5/22 (23%)
LRR_RI 147..397 CDD:238064 83/258 (32%)
leucine-rich repeat 169..192 CDD:275380 6/22 (27%)
leucine-rich repeat 193..217 CDD:275380 10/23 (43%)
LRR_8 217..276 CDD:290566 21/63 (33%)
leucine-rich repeat 218..241 CDD:275380 8/22 (36%)
leucine-rich repeat 242..265 CDD:275380 9/27 (33%)
LRR_8 265..321 CDD:290566 14/55 (25%)
leucine-rich repeat 266..289 CDD:275380 5/22 (23%)
leucine-rich repeat 290..313 CDD:275380 6/22 (27%)
LRR_8 312..374 CDD:290566 22/61 (36%)
leucine-rich repeat 314..335 CDD:275380 7/20 (35%)
leucine-rich repeat 339..363 CDD:275380 10/23 (43%)
LRRCT 395..445 CDD:214507 13/51 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45617
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.