DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment conv and Lrt

DIOPT Version :9

Sequence 1:NP_001286416.1 Gene:conv / 36588 FlyBaseID:FBgn0261269 Length:1092 Species:Drosophila melanogaster
Sequence 2:NP_001286640.1 Gene:Lrt / 37342 FlyBaseID:FBgn0034540 Length:830 Species:Drosophila melanogaster


Alignment Length:613 Identity:153/613 - (24%)
Similarity:247/613 - (40%) Gaps:99/613 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   492 LSHNSMREIKSSTFGTLPTLLEMDLSHNELVSVVRGSLAKLTSLRQLYLNNNQLEKLFQLP---- 552
            ::.:|.|:.|:....:||  |.:|      .:::......:|..|     |.:||....||    
  Fly   103 VNKSSPRKRKAEQVSSLP--LPVD------DALMEWKCPNITGTR-----NAELECGCDLPHTLR 154

  Fly   553 --ISLNELYFSHNRLTNIPSGTWPVMNSLIYLDLSHNQ---LGDT--LNGESFTGLLVVQRLKLQ 610
              |.|:.:....:||...|       .|:..||.|...   |.|.  .:..|..||::      .
  Fly   155 CNIDLHGMMLLADRLRTSP-------YSISLLDCSLRNVTFLSDAKIFDNVSLHGLVI------S 206

  Fly   611 NNGISQPPKDA-VAVMSTLQYLHLENNNITTLERSAFGKLPVLFELNLYGNQVKDISKRAFEGLL 674
            :..|.:..|.| :.:...||.|.|..|.:.::..:|...|..|..|:|..|::|.:....|.||.
  Fly   207 SGEIKRVHKSAFLGIRGPLQALGLPGNALMSVPWNALSTLSALERLDLANNKIKALGTADFVGLT 271

  Fly   675 QLLTLNLSSNGIQTLQNDIFVGLPSLRNLDLSFNSLTKLDNKTNGVLDDLLSLETLDLSHNRISF 739
            .|:.|.||:|.|.::....||.|..|..|.|..|.|......... |...|||..|||..|.::.
  Fly   272 SLVYLELSNNQISSISQRTFVNLRKLEVLKLGGNRLGDYAQSLRS-LSQCLSLRQLDLQANNLNG 335

  Fly   740 -VTKKTFPSHQYIPYNLRNLNLSYNLMPILTYDITFGTKKLVRLDVSHNQINDLRRGVISNFTSL 803
             ::::|.|..:    ||.:|||:.||:..:.........:||.|.:.||||:.|:........:|
  Fly   336 PLSEQTLPGMR----NLESLNLNRNLIKSIQNKALANFSRLVSLSLRHNQIDVLQDHAFFGLGAL 396

  Fly   804 QSLDMSYNELSNLKSE--EHIFDLPQNLSWLDLSHNKIYHLPFANLVKVKSLKYVDLTNNSLEDV 866
            .|||:|||.:..:.|.  :|:    ..|:.|||:||.:..|....:..:.||:.:.|..|.:..|
  Fly   397 DSLDLSYNGIVAISSASLQHL----SRLTVLDLTHNFLRALTSDLIAPLPSLRELRLAGNDISIV 457

  Fly   867 PASIVGSMRNGSQVLLAGNPLHCGCNARPLKYFMLQQTIAGEDLKSIYCGTPALIKDKQLISLDD 931
            ..:.:...|....:.:..|||.|.|:.||...: ||::.....| |..|.||..::...|:.:..
  Fly   458 ARNAMDGARELESLQMQENPLSCDCSIRPFAEW-LQESQLHSSL-SASCVTPPRLEGAPLLQVPV 520

  Fly   932 EYLHCAEDEQEMYKGIDYEQL----------------TDVRFREVKTNKAGMLTLCWYVSGFSDV 980
            |.|.|..|..|.......:.|                .::...|:..:....|.|.|.::  ...
  Fly   521 ETLSCDMDNVEKDNANIMQHLETLAKPNQTSPIKDLSEEIILHELHFSTDYGLILTWLLN--LSK 583

  Fly   981 SDF-----HVYIRSSSNDVL------H-QSDYAYNNRTAQIPVEELSTL--GEEKLRGAEICIV- 1030
            .|:     .||.....|::|      | :|.......|..:.|.:.|:|  ||    ....|:| 
  Fly   584 KDYMCDAIFVYKEEHINEILIDNSPIHCESKVVNGQNTVSVIVPDSSSLEIGE----SYRFCLVM 644

  Fly  1031 ----SRDSDGNTRKWFSGQCQQLPSLKR 1054
                ..||:.|.      .|..:..|:|
  Fly   645 IQEQKPDSELNI------GCSNITRLER 666

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
convNP_001286416.1 leucine-rich repeat 125..148 CDD:275380
leucine-rich repeat 150..175 CDD:275380
leucine-rich repeat 176..199 CDD:275380
LRR_8 198..258 CDD:290566
leucine-rich repeat 200..223 CDD:275380
LRR_RI 201..545 CDD:238064 10/52 (19%)
leucine-rich repeat 224..271 CDD:275380
LRR_8 245..306 CDD:290566
leucine-rich repeat 272..295 CDD:275380
LRR_8 296..354 CDD:290566
leucine-rich repeat 296..319 CDD:275380
LRR_8 322..401 CDD:290566
leucine-rich repeat 322..343 CDD:275380
leucine-rich repeat 344..367 CDD:275380
leucine-rich repeat 371..390 CDD:275380
leucine-rich repeat 391..414 CDD:275380
leucine-rich repeat 416..438 CDD:275380
LRR_8 437..495 CDD:290566 0/2 (0%)
leucine-rich repeat 439..462 CDD:275380
leucine-rich repeat 463..486 CDD:275380
LRR_RI 486..738 CDD:238064 68/257 (26%)
LRR_8 486..545 CDD:290566 10/52 (19%)
leucine-rich repeat 487..510 CDD:275380 4/17 (24%)
leucine-rich repeat 511..534 CDD:275380 2/22 (9%)
leucine-rich repeat 535..554 CDD:275380 6/24 (25%)
LRR_8 554..614 CDD:290566 13/64 (20%)
leucine-rich repeat 555..578 CDD:275380 4/22 (18%)
leucine-rich repeat 579..603 CDD:275380 8/28 (29%)
leucine-rich repeat 604..627 CDD:275380 3/23 (13%)
LRR_8 626..710 CDD:290566 28/83 (34%)
leucine-rich repeat 628..649 CDD:275380 6/20 (30%)
leucine-rich repeat 652..672 CDD:275380 6/19 (32%)
LRR_8 698..765 CDD:290566 21/67 (31%)
leucine-rich repeat 700..726 CDD:275380 6/25 (24%)
leucine-rich repeat 727..745 CDD:275380 5/18 (28%)
LRR_8 777..839 CDD:290566 23/63 (37%)
leucine-rich repeat 779..802 CDD:275380 8/22 (36%)
leucine-rich repeat 829..852 CDD:275380 7/22 (32%)
LrtNP_001286640.1 LRR_RI <151..334 CDD:238064 54/196 (28%)
leucine-rich repeat 179..199 CDD:275378 5/19 (26%)
leucine-rich repeat 200..223 CDD:275380 5/28 (18%)
leucine-rich repeat 225..248 CDD:275380 7/22 (32%)
LRR_8 249..307 CDD:290566 21/57 (37%)
leucine-rich repeat 249..272 CDD:275380 8/22 (36%)
LRR_RI <270..479 CDD:238064 64/217 (29%)
leucine-rich repeat 273..296 CDD:275380 9/22 (41%)
leucine-rich repeat 297..322 CDD:275380 6/25 (24%)
LRR_8 322..382 CDD:290566 20/63 (32%)
leucine-rich repeat 323..347 CDD:275380 7/27 (26%)
leucine-rich repeat 348..371 CDD:275380 6/22 (27%)
LRR_8 370..428 CDD:290566 21/61 (34%)
leucine-rich repeat 372..395 CDD:275380 8/22 (36%)
leucine-rich repeat 396..419 CDD:275380 9/26 (35%)
LRR_8 418..478 CDD:290566 14/59 (24%)
leucine-rich repeat 420..443 CDD:275380 7/22 (32%)
leucine-rich repeat 444..467 CDD:275380 4/22 (18%)
LRRCT 476..526 CDD:214507 17/51 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.