DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment conv and CG14762

DIOPT Version :10

Sequence 1:NP_610948.2 Gene:conv / 36588 FlyBaseID:FBgn0261269 Length:1092 Species:Drosophila melanogaster
Sequence 2:NP_001246198.1 Gene:CG14762 / 35768 FlyBaseID:FBgn0033250 Length:498 Species:Drosophila melanogaster


Alignment Length:460 Identity:128/460 - (27%)
Similarity:213/460 - (46%) Gaps:70/460 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   345 ELLDLAENNITKIEKNSFKDIYQAI--INVSHNALELIETAAFENCVNITVLDLSHNRLANFSRR 407
            |..|||  :||| ...:.|.....|  :.:.||.|..::...|      ..||:.|..:.|.|..
  Fly    62 ETTDLA--HITK-SMGTLKGKSPIIFYLKLRHNNLPKLQGFVF------LALDIRHLTIHNSSLA 117

  Fly   408 SFDETTFATYFQLSYNNLTNLAQIPIQNMTGLKVLNASYNSITEIPKNCFPKLYELHTIDVSHNN 472
            :.:|           |.|::|.       .||..|:.|.|.:..:|......|:.|..::::||.
  Fly   118 AIEE-----------NALSSLG-------AGLTQLDVSLNQMKTVPSQALQHLFHLLILNLNHNK 164

  Fly   473 ISSIFNGVFQTLFSLRSIDLSHNSMREIKSSTF-GTLPTLLEMDLSHNELVSVVRGSLAKLTSLR 536
            |:.|.|..|:.|.:|..:.|..|.:.:|....| |....:..::|..|:|.::.:.:|:.|::|:
  Fly   165 ITVIHNNAFEGLETLEILTLYENKITQIDPEAFRGLEDHIKRLNLGGNDLTNIPQKALSILSTLK 229

  Fly   537 QLYLNNNQLEKL----FQLPISLNELYFSHNRLTNIPSGTWPVMNSLIYLDLSHNQLGDTLNGES 597
            :|.:..|::..:    |:...||:.|..:||.:|.:|:..:..:..|..|:|..|:: ..::.::
  Fly   230 KLEIQENKIRTISEGDFEGLQSLDSLILAHNMITTVPANVFSHLTLLNSLELEGNKI-SVIDKDA 293

  Fly   598 FTGLLV-VQRLKLQNNGISQPPKDAVAVMSTLQYLHLENNNITTLERSAF-GKLPVLFELNLYGN 660
            |.||.. :|.|:|.:|.|...|.:|:..:..|::|.|.||||..|...|| |....|..|||..|
  Fly   294 FKGLEENLQYLRLGDNQIHTIPSEALRPLHRLRHLDLRNNNINVLAEDAFTGFGDSLTFLNLQKN 358

  Fly   661 QVKDISKRAFEGLLQLLTLNLSSNGIQTLQNDIFVG-LPSLRNLDLSFNSLT------------- 711
            .:|.:....||.|..|.||||.:|.:|.:..||... :.:||.:|::.|.|.             
  Fly   359 DIKVLPSLLFENLNSLETLNLQNNKLQRIPQDIMEPVIDTLRIIDITDNPLNCSCELTWFPKLLE 423

  Fly   712 KLDNKTNGVLDDLLSLETLDLSH----NRISFVTKKTFPSHQYIPYNLRNLNLSYN-----LMPI 767
            .|.||     ||.:|.:...|.|    ||..||  :..|:.:   .:...||:|.:     ||.|
  Fly   424 DLKNK-----DDEMSQKKKPLCHMSLDNREYFV--QAMPTEK---MHCAGLNVSPSPTSGGLMRI 478

  Fly   768 LTYDI 772
            |..:|
  Fly   479 LQVNI 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
convNP_610948.2 leucine-rich repeat 125..148 CDD:275380
leucine-rich repeat 150..175 CDD:275380
leucine-rich repeat 176..199 CDD:275380
PPP1R42 191..359 CDD:455733 7/13 (54%)
LRR_8 198..258 CDD:404697
leucine-rich repeat 200..223 CDD:275380
leucine-rich repeat 224..271 CDD:275380
leucine-rich repeat 272..295 CDD:275380
leucine-rich repeat 296..319 CDD:275380
leucine-rich repeat 322..343 CDD:275380
leucine-rich repeat 344..367 CDD:275380 8/21 (38%)
LRR 346..718 CDD:443914 109/394 (28%)
leucine-rich repeat 371..390 CDD:275380 4/18 (22%)
leucine-rich repeat 391..414 CDD:275380 6/22 (27%)
leucine-rich repeat 416..438 CDD:275380 3/21 (14%)
leucine-rich repeat 439..462 CDD:275380 6/22 (27%)
leucine-rich repeat 463..486 CDD:275380 8/22 (36%)
leucine-rich repeat 487..510 CDD:275380 6/23 (26%)
leucine-rich repeat 511..534 CDD:275380 5/22 (23%)
leucine-rich repeat 535..554 CDD:275380 4/22 (18%)
leucine-rich repeat 555..578 CDD:275380 6/22 (27%)
leucine-rich repeat 579..603 CDD:275380 7/23 (30%)
leucine-rich repeat 604..627 CDD:275380 7/22 (32%)
leucine-rich repeat 628..649 CDD:275380 11/21 (52%)
PPP1R42 631..849 CDD:455733 54/166 (33%)
leucine-rich repeat 652..672 CDD:275380 7/19 (37%)
leucine-rich repeat 700..726 CDD:275380 10/38 (26%)
leucine-rich repeat 727..745 CDD:275380 6/21 (29%)
leucine-rich repeat 779..802 CDD:275380
leucine-rich repeat 829..852 CDD:275380
CG14762NP_001246198.1 leucine-rich repeat 85..105 CDD:275380 4/25 (16%)
leucine-rich repeat 107..129 CDD:275380 7/39 (18%)
LRR <131..410 CDD:443914 83/279 (30%)
leucine-rich repeat 131..154 CDD:275380 6/22 (27%)
leucine-rich repeat 155..178 CDD:275380 8/22 (36%)
leucine-rich repeat 179..203 CDD:275380 6/23 (26%)
leucine-rich repeat 204..227 CDD:275380 5/22 (23%)
leucine-rich repeat 228..251 CDD:275380 4/22 (18%)
leucine-rich repeat 252..275 CDD:275380 6/22 (27%)
leucine-rich repeat 276..300 CDD:275380 7/24 (29%)
leucine-rich repeat 301..324 CDD:275380 7/22 (32%)
leucine-rich repeat 325..349 CDD:275380 11/23 (48%)
leucine-rich repeat 350..373 CDD:275380 9/22 (41%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.