DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment conv and CG5096

DIOPT Version :9

Sequence 1:NP_001286416.1 Gene:conv / 36588 FlyBaseID:FBgn0261269 Length:1092 Species:Drosophila melanogaster
Sequence 2:NP_723576.1 Gene:CG5096 / 34410 FlyBaseID:FBgn0032235 Length:491 Species:Drosophila melanogaster


Alignment Length:431 Identity:104/431 - (24%)
Similarity:173/431 - (40%) Gaps:95/431 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   566 TNIPSGTWPVMNSLI------YLDLS----HNQLGDTLNGESF----TGLLVVQRLKLQNNGISQ 616
            |..|.....|::|.:      |:|.:    ..:|.|.|:.|.:    .|.:|.:.:.|::|.::.
  Fly    32 TETPKEKIKVIDSKLCKKCNCYIDTNLLDCSEKLQDWLSAEDWEDLTNGNVVFKTINLEHNNLTS 96

  Fly   617 PPKDAVAVMSTLQYLHLENNNITTLERSAFGKLPVLFELNLYGNQ------VKDISK-----RAF 670
            .|   :.....::.|:|.||.|.::...||..|..|..|:|..|:      |.|:.|     :.|
  Fly    97 VP---ILPKYDVENLYLANNQIDSISVGAFQNLTELVTLDLSHNRLTSKVLVPDVFKGPFTVQDF 158

  Fly   671 EGLLQLLTLNLSSNGIQTLQNDIFVGLPSLRNLDLSFNSLTKLDNKTNGVLDDLLSLETLDLSHN 735
            |.|..|.||||..|.:.:|..|:|..:|.:..|.|..||...:|..:...:..|.||:.||:|:.
  Fly   159 ESLENLKTLNLGYNDLHSLDADLFEHIPHIEELVLCSNSFHVIDQLSETAISGLQSLKILDVSYM 223

  Fly   736 RIS---------------FVTK----KTFPSHQYIPYNLRNLNLSYNLMPILTYDITF-GTKKLV 780
            .|.               |:..    ...|.......||.:|.|:.|.:..|..|..| ...||.
  Fly   224 EIDDLPDTILHGPRDLEIFIAAGNLFNQLPKALKYATNLTSLVLNENPIENLIGDNVFPPLTKLT 288

  Fly   781 RLDVSH-NQINDLRRGVISNFTSLQSLDMSYNELSNLKSEEHIFDLPQNLS---WLD-------- 833
            .|.::. :::..:..|..|...||..|.:|.|:|.|...||   .|.:|::   :||        
  Fly   289 HLSMTFMSKLYKIGPGAFSELQSLTELILSDNKLLNEIDEE---ALSKNVTGGQYLDYPPLEKVY 350

  Fly   834 LSHNKIYHLPFANLVKVKSLKYVDLTNN-----SLEDVPASIVGSMRNGSQVLLAGNPLHCGCNA 893
            |::..:..||...||:...||.:||..|     ...|...:::....|.:..:||          
  Fly   351 LNNCNVSTLPKELLVRWDKLKALDLRFNPWNCDESNDFLINVLIDRINKTTPVLA---------- 405

  Fly   894 RPLKYFMLQQTIAGEDLKSIYCGTPALIKDKQLISLDDEYL 934
                             |.:.||.|..:.|..|:.:.:|::
  Fly   406 -----------------KDVKCGGPNKLNDVTLLRVANEHM 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
convNP_001286416.1 leucine-rich repeat 125..148 CDD:275380
leucine-rich repeat 150..175 CDD:275380
leucine-rich repeat 176..199 CDD:275380
LRR_8 198..258 CDD:290566
leucine-rich repeat 200..223 CDD:275380
LRR_RI 201..545 CDD:238064
leucine-rich repeat 224..271 CDD:275380
LRR_8 245..306 CDD:290566
leucine-rich repeat 272..295 CDD:275380
LRR_8 296..354 CDD:290566
leucine-rich repeat 296..319 CDD:275380
LRR_8 322..401 CDD:290566
leucine-rich repeat 322..343 CDD:275380
leucine-rich repeat 344..367 CDD:275380
leucine-rich repeat 371..390 CDD:275380
leucine-rich repeat 391..414 CDD:275380
leucine-rich repeat 416..438 CDD:275380
LRR_8 437..495 CDD:290566
leucine-rich repeat 439..462 CDD:275380
leucine-rich repeat 463..486 CDD:275380
LRR_RI 486..738 CDD:238064 54/196 (28%)
LRR_8 486..545 CDD:290566
leucine-rich repeat 487..510 CDD:275380
leucine-rich repeat 511..534 CDD:275380
leucine-rich repeat 535..554 CDD:275380
LRR_8 554..614 CDD:290566 14/61 (23%)
leucine-rich repeat 555..578 CDD:275380 3/11 (27%)
leucine-rich repeat 579..603 CDD:275380 7/37 (19%)
leucine-rich repeat 604..627 CDD:275380 3/22 (14%)
LRR_8 626..710 CDD:290566 31/94 (33%)
leucine-rich repeat 628..649 CDD:275380 7/20 (35%)
leucine-rich repeat 652..672 CDD:275380 8/30 (27%)
LRR_8 698..765 CDD:290566 20/85 (24%)
leucine-rich repeat 700..726 CDD:275380 6/25 (24%)
leucine-rich repeat 727..745 CDD:275380 6/36 (17%)
LRR_8 777..839 CDD:290566 19/73 (26%)
leucine-rich repeat 779..802 CDD:275380 4/23 (17%)
leucine-rich repeat 829..852 CDD:275380 7/33 (21%)
CG5096NP_723576.1 LRR_RI 69..378 CDD:238064 84/314 (27%)
leucine-rich repeat 85..104 CDD:275380 3/21 (14%)
LRR_8 105..174 CDD:290566 24/68 (35%)
leucine-rich repeat 105..128 CDD:275380 8/22 (36%)
leucine-rich repeat 129..163 CDD:275380 10/33 (30%)
LRR_8 163..222 CDD:290566 20/58 (34%)
leucine-rich repeat 164..187 CDD:275380 9/22 (41%)
leucine-rich repeat 188..214 CDD:275380 6/25 (24%)
leucine-rich repeat 215..238 CDD:275380 5/22 (23%)
leucine-rich repeat 239..261 CDD:275380 2/21 (10%)
LRR_8 260..322 CDD:290566 18/61 (30%)
leucine-rich repeat 262..286 CDD:275380 7/23 (30%)
leucine-rich repeat 287..311 CDD:275380 4/23 (17%)
leucine-rich repeat 346..369 CDD:275380 5/22 (23%)
leucine-rich repeat 370..388 CDD:275380 5/17 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45617
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.