DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment conv and Tsku

DIOPT Version :10

Sequence 1:NP_610948.2 Gene:conv / 36588 FlyBaseID:FBgn0261269 Length:1092 Species:Drosophila melanogaster
Sequence 2:NP_001009965.2 Gene:Tsku / 308843 RGDID:1359311 Length:353 Species:Rattus norvegicus


Alignment Length:322 Identity:93/322 - (28%)
Similarity:134/322 - (41%) Gaps:84/322 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   394 LDLSHNRLANFSRRSFDETTFATYFQLSYNNLTNLAQIPIQNMTGLKVLNASYNSITEIPKNCFP 458
            ||||.|||         ||             .|.:.:.....|.|..|:.|:|.:|.|....|.
  Rat    64 LDLSSNRL---------ET-------------VNESVLGGPGYTTLAGLDLSHNLLTSITPTAFS 106

  Fly   459 KLYELHTIDVSHNNISSIFNGVFQTLFSLRSIDLSHNSMREIKSSTFGT--LPTLLEMDLSHNEL 521
            :|..|.::|:|||.::::...|| |...|..|:||||.:||:..|.|.|  ....|.:|||||.:
  Rat   107 RLRYLESLDLSHNGLAALPAEVF-TSSPLSDINLSHNRLREVSISAFTTHSQGRALHVDLSHNLI 170

  Fly   522 VSVV----RGSLAKLTSLRQLYLNNNQLEKLFQLPISLNELYFSHNRLTNIPS-GTWPVMNSLIY 581
            ..::    |.||:..|                     :..|..|.|||..:|: ...|    |.|
  Rat   171 HRLLPYPARASLSAPT---------------------IQSLNLSWNRLRAVPNLRDLP----LRY 210

  Fly   582 LDLSHNQLGDTLNGESFTGLLVVQRLKLQN-NGISQ-PPKDAVAVMSTLQYLHLENNNITTLERS 644
            |.|..|.|. |:|..:|.||..:..|.|.: .||.| ||                         .
  Rat   211 LSLDGNPLA-TINPGAFMGLAGLTHLSLASLQGILQLPP-------------------------H 249

  Fly   645 AFGKLPVLFELNLYGN-QVKDISKRAFEGLLQLLTLNLSSNGIQTLQNDIFVGLPSLRNLDL 705
            .|.:||.|..|:|.|| ::|......|.||..|..|:||.:.:..|...:...||:|:::.:
  Rat   250 GFRELPGLQVLDLSGNPKLKWAGAEVFSGLGLLQELDLSGSSLVPLPETLLHHLPALQSVSV 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
convNP_610948.2 leucine-rich repeat 125..148 CDD:275380
leucine-rich repeat 150..175 CDD:275380
leucine-rich repeat 176..199 CDD:275380
PPP1R42 191..359 CDD:455733
LRR_8 198..258 CDD:404697
leucine-rich repeat 200..223 CDD:275380
leucine-rich repeat 224..271 CDD:275380
leucine-rich repeat 272..295 CDD:275380
leucine-rich repeat 296..319 CDD:275380
leucine-rich repeat 322..343 CDD:275380
leucine-rich repeat 344..367 CDD:275380
LRR 346..718 CDD:443914 93/322 (29%)
leucine-rich repeat 371..390 CDD:275380
leucine-rich repeat 391..414 CDD:275380 9/19 (47%)
leucine-rich repeat 416..438 CDD:275380 1/21 (5%)
leucine-rich repeat 439..462 CDD:275380 8/22 (36%)
leucine-rich repeat 463..486 CDD:275380 8/22 (36%)
leucine-rich repeat 487..510 CDD:275380 11/24 (46%)
leucine-rich repeat 511..534 CDD:275380 9/26 (35%)
leucine-rich repeat 535..554 CDD:275380 0/18 (0%)
leucine-rich repeat 555..578 CDD:275380 7/23 (30%)
leucine-rich repeat 579..603 CDD:275380 11/23 (48%)
leucine-rich repeat 604..627 CDD:275380 7/24 (29%)
leucine-rich repeat 628..649 CDD:275380 1/20 (5%)
PPP1R42 631..849 CDD:455733 20/76 (26%)
leucine-rich repeat 652..672 CDD:275380 7/20 (35%)
leucine-rich repeat 700..726 CDD:275380 1/6 (17%)
leucine-rich repeat 727..745 CDD:275380
leucine-rich repeat 779..802 CDD:275380
leucine-rich repeat 829..852 CDD:275380
TskuNP_001009965.2 LRR 1 60..80 10/37 (27%)
leucine-rich repeat 63..86 CDD:275380 10/43 (23%)
LRR <85..>306 CDD:443914 82/272 (30%)
LRR 2 86..107 7/20 (35%)
leucine-rich repeat 90..110 CDD:275380 7/19 (37%)
LRR 3 110..131 7/21 (33%)
leucine-rich repeat 111..133 CDD:275380 8/22 (36%)
LRR 4 133..154 10/20 (50%)
leucine-rich repeat 134..159 CDD:275380 11/24 (46%)
leucine-rich repeat 160..186 CDD:275380 9/25 (36%)
LRR 5 160..180 6/19 (32%)
LRR 6 186..207 7/41 (17%)
leucine-rich repeat 187..205 CDD:275380 6/17 (35%)
leucine-rich repeat 208..231 CDD:275380 11/23 (48%)
LRR 7 208..228 9/20 (45%)
LRR 8 231..253 8/46 (17%)
leucine-rich repeat 232..256 CDD:275380 9/48 (19%)
LRR 9 256..277 6/20 (30%)
leucine-rich repeat 257..281 CDD:275380 9/23 (39%)
LRR 10 281..302 5/20 (25%)
leucine-rich repeat 282..305 CDD:275380 6/22 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.