DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment conv and dma-1

DIOPT Version :9

Sequence 1:NP_001286416.1 Gene:conv / 36588 FlyBaseID:FBgn0261269 Length:1092 Species:Drosophila melanogaster
Sequence 2:NP_492253.1 Gene:dma-1 / 187968 WormBaseID:WBGene00011345 Length:603 Species:Caenorhabditis elegans


Alignment Length:559 Identity:140/559 - (25%)
Similarity:229/559 - (40%) Gaps:89/559 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   377 LELIETAAFENCVNITVLDLSHNRLANFSRRS-FDETTFATYFQLSYNNLTNLAQIPIQNMTGLK 440
            |.|...|...:|.|:...|.:.:..:.:.|:: .::|.:|.........|.:|...|..|..|..
 Worm    13 LVLCSIALPSSCPNLCECDQNDSSWSVYCRKAIINDTIYAEILNQLPLTLRSLHIQPPSNRIGSN 77

  Fly   441 VLNASYNSITEIPKNCFPKLYELHTIDVSHNNISSIFNGVFQTLFSLRSIDLSHNSMREIKSSTF 505
            .|..:.|.      |.|.:|..|..|:.   .|.::...:  .|.||..:||..|::.....|.|
 Worm    78 KLRWNDNI------NRFAQLRVLRLINC---QIPAMSRSI--RLPSLEVLDLHSNNIEHATMSNF 131

  Fly   506 GTLPTLLEMDLSHNELVSVVRGSLAKLTSLRQLYLNNNQLEKLFQLPISLNELYFSHNRLTNIPS 570
            |.:|.|..:|||.|.|..:..|....|.:||.|.|:||.:..|                .||:..
 Worm   132 GGMPKLRVLDLSSNHLNILPTGVFTYLRALRSLSLSNNTISDL----------------STNLLR 180

  Fly   571 GTWPVMNSLIYLDLSHNQLGDTLNGESFTGLLVVQRLKLQNNGISQPPKDAVAVMSTLQYLHLEN 635
            |    :|||..|.|..|.:......|.||.                        :|.|..|:|.:
 Worm   181 G----LNSLRVLRLDRNPIPIEHINELFTD------------------------VSQLDELYLNH 217

  Fly   636 NNITTLERSAFGKLPVLFELNLYGNQVKDISKRAFEGLLQLLTLNLSSNGIQTLQNDIFVGLPSL 700
            .|::::...|..::|.|.:|.:.||.:|.:..:....|.||..|:||.|.||.:....|.. .::
 Worm   218 CNLSSIYSLALDRIPQLRQLGIGGNNLKMVPTKELRSLPQLSVLDLSHNSIQEITACAFCN-TNI 281

  Fly   701 RNLDLSFNSL-TKLDNKTNGVLDDLLSLETLDLSHNRISFVTKKTFPSHQYIPYNLRNLNLSYNL 764
            ..||||.|.| ...|:..|......:.|..||||.|.::....|..   .:....|.::.||.|.
 Worm   282 SKLDLSHNLLGISKDSPFNEDAFRTMPLRHLDLSFNHMNDFDSKWL---GWAQEELTSIALSGNF 343

  Fly   765 MPILTYDITFGTKKLVRLDVSHNQINDLRRGVISNFTSLQSLDMSYNELSNLKSEEHIFDLPQNL 829
            :.......|:..|.|:.|::::|.|..:...:.|.:..|.||::|.|||:.         ||.|:
 Worm   344 LKNFEESWTYTLKSLIHLELAYNHIKFIPVQLPSRYYHLISLNISGNELTY---------LPDNI 399

  Fly   830 SWLDLSHNKIYHLPFANLVKVKSLKYVDLTNNSLEDVPASIVGSMRNGSQVLLAGNPLHCGCNAR 894
            :.|         ||        ::|..|:|.|.......:.:..:.|..||.:.|||..|.|..:
 Worm   400 NTL---------LP--------NVKTFDITANRFHTFSHTDLAFLNNVEQVYVDGNPWDCSCAIQ 447

  Fly   895 PLKYFMLQQTIAGEDLK--SIYCGTPALIKDKQLISLDD 931
            .|:..|..:......|.  ::.|.||:|::...::::.|
 Worm   448 GLQVHMRDRYAMRHILNYDNVRCATPSLVEGHSVLAITD 486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
convNP_001286416.1 leucine-rich repeat 125..148 CDD:275380
leucine-rich repeat 150..175 CDD:275380
leucine-rich repeat 176..199 CDD:275380
LRR_8 198..258 CDD:290566
leucine-rich repeat 200..223 CDD:275380
LRR_RI 201..545 CDD:238064 46/168 (27%)
leucine-rich repeat 224..271 CDD:275380
LRR_8 245..306 CDD:290566
leucine-rich repeat 272..295 CDD:275380
LRR_8 296..354 CDD:290566
leucine-rich repeat 296..319 CDD:275380
LRR_8 322..401 CDD:290566 6/23 (26%)
leucine-rich repeat 322..343 CDD:275380
leucine-rich repeat 344..367 CDD:275380
leucine-rich repeat 371..390 CDD:275380 4/12 (33%)
leucine-rich repeat 391..414 CDD:275380 3/23 (13%)
leucine-rich repeat 416..438 CDD:275380 4/21 (19%)
LRR_8 437..495 CDD:290566 14/57 (25%)
leucine-rich repeat 439..462 CDD:275380 5/22 (23%)
leucine-rich repeat 463..486 CDD:275380 4/22 (18%)
LRR_RI 486..738 CDD:238064 72/252 (29%)
LRR_8 486..545 CDD:290566 23/58 (40%)
leucine-rich repeat 487..510 CDD:275380 7/22 (32%)
leucine-rich repeat 511..534 CDD:275380 8/22 (36%)
leucine-rich repeat 535..554 CDD:275380 7/18 (39%)
LRR_8 554..614 CDD:290566 12/59 (20%)
leucine-rich repeat 555..578 CDD:275380 3/22 (14%)
leucine-rich repeat 579..603 CDD:275380 7/23 (30%)
leucine-rich repeat 604..627 CDD:275380 0/22 (0%)
LRR_8 626..710 CDD:290566 27/83 (33%)
leucine-rich repeat 628..649 CDD:275380 5/20 (25%)
leucine-rich repeat 652..672 CDD:275380 5/19 (26%)
LRR_8 698..765 CDD:290566 19/67 (28%)
leucine-rich repeat 700..726 CDD:275380 8/26 (31%)
leucine-rich repeat 727..745 CDD:275380 7/17 (41%)
LRR_8 777..839 CDD:290566 17/61 (28%)
leucine-rich repeat 779..802 CDD:275380 5/22 (23%)
leucine-rich repeat 829..852 CDD:275380 3/22 (14%)
dma-1NP_492253.1 LRR_8 90..147 CDD:338972 19/61 (31%)
leucine-rich repeat 91..112 CDD:275380 5/25 (20%)
leucine-rich repeat 113..136 CDD:275380 7/22 (32%)
LRR 136..430 CDD:227223 92/367 (25%)
leucine-rich repeat 137..160 CDD:275380 8/22 (36%)
leucine-rich repeat 161..184 CDD:275380 10/42 (24%)
leucine-rich repeat 185..209 CDD:275380 7/47 (15%)
leucine-rich repeat 210..233 CDD:275380 5/22 (23%)
leucine-rich repeat 234..257 CDD:275380 6/22 (27%)
leucine-rich repeat 258..280 CDD:275380 8/22 (36%)
leucine-rich repeat 281..307 CDD:275380 8/25 (32%)
leucine-rich repeat 309..357 CDD:275380 12/50 (24%)
leucine-rich repeat 382..405 CDD:275380 13/48 (27%)
leucine-rich repeat 406..429 CDD:275380 4/22 (18%)
TPKR_C2 438..>478 CDD:387596 11/39 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45617
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.