DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment conv and tlr1

DIOPT Version :10

Sequence 1:NP_610948.2 Gene:conv / 36588 FlyBaseID:FBgn0261269 Length:1092 Species:Drosophila melanogaster
Sequence 2:XP_017950843.2 Gene:tlr1 / 100495171 XenbaseID:XB-GENE-5997911 Length:812 Species:Xenopus tropicalis


Alignment Length:39 Identity:12/39 - (30%)
Similarity:16/39 - (41%) Gaps:3/39 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 EDDDTTDTEMPPKSAFILRAQFYQNLFAASANLLKKQRP 121
            |:.|..|.::..:|...|.....||....|.||   .||
 Frog   158 EELDLGDCDLGIQSLIALATVLLQNKTLKSLNL---NRP 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
convNP_610948.2 leucine-rich repeat 125..148 CDD:275380
leucine-rich repeat 150..175 CDD:275380
leucine-rich repeat 176..199 CDD:275380
PPP1R42 191..359 CDD:455733
LRR_8 198..258 CDD:404697
leucine-rich repeat 200..223 CDD:275380
leucine-rich repeat 224..271 CDD:275380
leucine-rich repeat 272..295 CDD:275380
leucine-rich repeat 296..319 CDD:275380
leucine-rich repeat 322..343 CDD:275380
leucine-rich repeat 344..367 CDD:275380
LRR 346..718 CDD:443914
leucine-rich repeat 371..390 CDD:275380
leucine-rich repeat 391..414 CDD:275380
leucine-rich repeat 416..438 CDD:275380
leucine-rich repeat 439..462 CDD:275380
leucine-rich repeat 463..486 CDD:275380
leucine-rich repeat 487..510 CDD:275380
leucine-rich repeat 511..534 CDD:275380
leucine-rich repeat 535..554 CDD:275380
leucine-rich repeat 555..578 CDD:275380
leucine-rich repeat 579..603 CDD:275380
leucine-rich repeat 604..627 CDD:275380
leucine-rich repeat 628..649 CDD:275380
PPP1R42 631..849 CDD:455733
leucine-rich repeat 652..672 CDD:275380
leucine-rich repeat 700..726 CDD:275380
leucine-rich repeat 727..745 CDD:275380
leucine-rich repeat 779..802 CDD:275380
leucine-rich repeat 829..852 CDD:275380
tlr1XP_017950843.2 LRR <53..270 CDD:443914 12/39 (31%)
leucine-rich repeat 65..87 CDD:275378
leucine-rich repeat 88..111 CDD:275378
leucine-rich repeat 112..135 CDD:275378
leucine-rich repeat 136..160 CDD:275378 1/1 (100%)
leucine-rich repeat 161..173 CDD:275378 3/11 (27%)
leucine-rich repeat 184..205 CDD:275380 5/13 (38%)
LRR <414..>543 CDD:443914
leucine-rich repeat 417..440 CDD:275380
leucine-rich repeat 441..462 CDD:275380
leucine-rich repeat 463..485 CDD:275380
leucine-rich repeat 486..508 CDD:275380
leucine-rich repeat 509..532 CDD:275380
LRRCT 541..>580 CDD:214507
TIR 653..794 CDD:214587
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.