DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment conv and prelp

DIOPT Version :10

Sequence 1:NP_610948.2 Gene:conv / 36588 FlyBaseID:FBgn0261269 Length:1092 Species:Drosophila melanogaster
Sequence 2:NP_001096208.1 Gene:prelp / 100124759 XenbaseID:XB-GENE-964437 Length:374 Species:Xenopus tropicalis


Alignment Length:361 Identity:102/361 - (28%)
Similarity:165/361 - (45%) Gaps:57/361 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   451 EIPKNCFPKLYELHTIDVSHNNISSIFNGVFQTLFS-LRSIDLSHNSMREIKSSTFGTLPTLLEM 514
            :.|:.||.......||.....|:..:     .||.: .|.:.|.:|.:.:::..:|.....:..:
 Frog    64 DCPRECFCPPDFPSTIYCDSRNLRKV-----PTLPNRARYVYLQNNFIDDLQEESFKNATEIQWI 123

  Fly   515 DLSHNELVSVVRGSLAKLTSLRQLYLNNNQLEKL-FQLPISLNELYFSHNRLTNIPSGTWPVMNS 578
            :|.:|.:..|.:..|.|:.:|..|||..|||::: ..||..|.:|..|.|:::.||||.:..|..
 Frog   124 NLDNNRIKKVEKKILEKMNNLTYLYLEKNQLKEMPSYLPSRLEQLRLSRNQISKIPSGVFSKMEH 188

  Fly   579 LIYLDLSHNQLGD-TLNGESFTGLLVVQRLKLQNNGISQPPKDAVAVMSTLQYLHLENNNITTLE 642
            |:.|||.||:|.| ..:..:|.||..:.:|.|.:|.:.:.|:   ||..::..|.|:.|||..:.
 Frog   189 LVLLDLHHNKLSDGGFSKNTFKGLKNLIQLNLAHNILRKMPQ---AVPESVNQLFLDRNNIEDIP 250

  Fly   643 RSAFGKLPVLFELNLYGNQVKDISKRAFEGLLQLLTLNLSSNGIQTLQNDIFVGLPSLRNLDLSF 707
            ...|.:||.|..|.|..||:.|      :||.:.| .|:|                ||..|.|:.
 Frog   251 ADYFKELPNLAFLRLNYNQLSD------KGLPKNL-FNVS----------------SLLVLQLAH 292

  Fly   708 NSLTKLDNKTNGVLDDL-LSLETLDLSHNRISFVTKKTFPSHQYIPYNLRNLNLSYNLMPILTYD 771
            |.||        |:..: :.||.|.|:.|.|..:..........:|::..:.:||  .:|.|.| 
 Frog   293 NKLT--------VVPPISIKLEHLYLNDNIIEKINGTEICPAPLVPFDFSSRDLS--SVPRLRY- 346

  Fly   772 ITFGTKKLVRLDVSHNQIN-DLRRGVISNFTSLQSL 806
                    :|||  .||:. .:...||..|..|||:
 Frog   347 --------LRLD--GNQLKPPIPLDVIMCFRLLQSV 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
convNP_610948.2 leucine-rich repeat 125..148 CDD:275380
leucine-rich repeat 150..175 CDD:275380
leucine-rich repeat 176..199 CDD:275380
PPP1R42 191..359 CDD:455733
LRR_8 198..258 CDD:404697
leucine-rich repeat 200..223 CDD:275380
leucine-rich repeat 224..271 CDD:275380
leucine-rich repeat 272..295 CDD:275380
leucine-rich repeat 296..319 CDD:275380
leucine-rich repeat 322..343 CDD:275380
leucine-rich repeat 344..367 CDD:275380
LRR 346..718 CDD:443914 78/269 (29%)
leucine-rich repeat 371..390 CDD:275380
leucine-rich repeat 391..414 CDD:275380
leucine-rich repeat 416..438 CDD:275380
leucine-rich repeat 439..462 CDD:275380 3/10 (30%)
leucine-rich repeat 463..486 CDD:275380 5/22 (23%)
leucine-rich repeat 487..510 CDD:275380 4/22 (18%)
leucine-rich repeat 511..534 CDD:275380 5/22 (23%)
leucine-rich repeat 535..554 CDD:275380 9/19 (47%)
leucine-rich repeat 555..578 CDD:275380 9/22 (41%)
leucine-rich repeat 579..603 CDD:275380 11/24 (46%)
leucine-rich repeat 604..627 CDD:275380 6/22 (27%)
leucine-rich repeat 628..649 CDD:275380 6/20 (30%)
PPP1R42 631..849 CDD:455733 50/178 (28%)
leucine-rich repeat 652..672 CDD:275380 6/19 (32%)
leucine-rich repeat 700..726 CDD:275380 7/26 (27%)
leucine-rich repeat 727..745 CDD:275380 6/17 (35%)
leucine-rich repeat 779..802 CDD:275380 8/23 (35%)
leucine-rich repeat 829..852 CDD:275380
prelpNP_001096208.1 LRRNT 64..98 CDD:214470 8/38 (21%)
leucine-rich repeat 96..119 CDD:275380 4/22 (18%)
LRR <112..>329 CDD:443914 74/250 (30%)
leucine-rich repeat 120..143 CDD:275380 5/22 (23%)
leucine-rich repeat 144..164 CDD:275380 9/19 (47%)
leucine-rich repeat 165..188 CDD:275380 9/22 (41%)
leucine-rich repeat 189..214 CDD:275380 11/24 (46%)
leucine-rich repeat 215..235 CDD:275380 6/22 (27%)
leucine-rich repeat 236..259 CDD:275380 7/22 (32%)
leucine-rich repeat 260..284 CDD:275380 11/46 (24%)
leucine-rich repeat 285..304 CDD:275380 7/26 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.