DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beta4GalNAcTA and TMA20

DIOPT Version :9

Sequence 1:NP_610946.1 Gene:beta4GalNAcTA / 36585 FlyBaseID:FBgn0027538 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_010923.3 Gene:TMA20 / 856725 SGDID:S000002957 Length:181 Species:Saccharomyces cerevisiae


Alignment Length:112 Identity:22/112 - (19%)
Similarity:37/112 - (33%) Gaps:31/112 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 SIRRVHKYAHIYGNASSD---------GAG------GSEASRLPASPLALSKDRERDQELNGGPN 91
            |::.|||:...|.....|         ||.      .|..:.||.:|              |...
Yeast    79 SLKLVHKFPEAYPTVQVDRGAIKFVLSGANIMCPGLTSAGADLPPAP--------------GYEK 129

  Fly    92 STIRTVIATANFTSIPQDLTRFLLGTKKFLPPRQKSTSALLANCTDP 138
            .||  |:..|........:...::||::.....:..:..|:.:..||
Yeast   130 GTI--VVINAENKENALAIGELMMGTEEIKSVNKGHSIELIHHLGDP 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beta4GalNAcTANP_610946.1 b4GalT 181..395 CDD:132999
TMA20NP_010923.3 Tma20 12..181 CDD:224927 22/112 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.