DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beta4GalNAcTA and B4galt3

DIOPT Version :9

Sequence 1:NP_610946.1 Gene:beta4GalNAcTA / 36585 FlyBaseID:FBgn0027538 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_065604.2 Gene:B4galt3 / 57370 MGIID:1928767 Length:395 Species:Mus musculus


Alignment Length:404 Identity:136/404 - (33%)
Similarity:202/404 - (50%) Gaps:78/404 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 IRFLAGA-ICLLLVLNFVGFRSDGGSATSLSKLSIR---RVHKYAH---IYGNASSDGAGGSEAS 67
            :..|.|: :.:::.|:..|||       |||.|..|   ....|:|   :|.|          .|
Mouse    12 LALLVGSQLAVMMYLSLGGFR-------SLSALFGRDPGPTFDYSHPHDVYSN----------LS 59

  Fly    68 RLPASPLALSKDRERDQELNGGPNSTIRTVIATANFTSIPQDLTRFLLGTKKFLPPRQKSTSALL 132
            .|||:|.|..                                           .||.|     .|
Mouse    60 HLPAAPGAAG-------------------------------------------APPAQ-----AL 76

  Fly   133 ANCTDPDPRDGGPITPN-TTLESLDVIEAELGPLLRPGGAFEPENCNAQHHVAIVVPFRDRYAHL 196
            ..|.:..|...||::.: :.:.||..| .|..|.:..||.:.|..|..:...||:||.|.|..||
Mouse    77 PYCPERSPFLVGPVSVSFSPVPSLAEI-VERNPRVESGGRYRPAGCEPRSRTAIIVPHRAREHHL 140

  Fly   197 LLFLRNIHPFLMKQRIAYRIFIVEQTNGKPFNRAAMMNIGYLEALKLYQWDCFIFHDVDLLPLDD 261
            .|.|.::||||.:|::||.|:::.|.....||||.::|:|..|||:..:|||...|||||||.:|
Mouse   141 RLLLYHLHPFLQRQQLAYGIYVIHQAGNGTFNRAKLLNVGVREALRDEEWDCLFLHDVDLLPEND 205

  Fly   262 RNLYNC-PRQPRHMSVAIDTLNFRLPYRSIFGGVSAMTREHFQAVNGFSNSFFGWGGEDDDMSNR 325
            .|||.| ||.|||::||::...:.|||...||||||:|.:.:..:|||.|.::||||||||::.|
Mouse   206 HNLYVCDPRGPRHVAVAMNKFGYSLPYPQYFGGVSALTPDQYLKMNGFPNEYWGWGGEDDDIATR 270

  Fly   326 LKHANLFISRYPVNIARYKMLKHQKEKA---NPKRYENLQNGMSKIEQDGINSIKYSIYSIKQFP 387
            ::.|.:.|||.|.::..|||:||:.:|.   ||.|::.|....:...|||:||:.|.:.:.:..|
Mouse   271 VRLAGMKISRPPTSVGHYKMVKHRGDKGNEENPHRFDLLVRTQNSWTQDGMNSLTYRLLARELGP 335

  Fly   388 TFTWYLAELKNSER 401
            .:|...|::....|
Mouse   336 LYTNITADIGTDPR 349

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
beta4GalNAcTANP_610946.1 b4GalT 181..395 CDD:132999 96/217 (44%)
B4galt3NP_065604.2 b4GalT 124..343 CDD:132999 96/218 (44%)
UDP-alpha-D-galactose binding. /evidence=ECO:0000250 132..136 2/3 (67%)
UDP-alpha-D-galactose binding. /evidence=ECO:0000250 171..173 1/1 (100%)