DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beta4GalNAcTA and b4galt5

DIOPT Version :9

Sequence 1:NP_610946.1 Gene:beta4GalNAcTA / 36585 FlyBaseID:FBgn0027538 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001016385.1 Gene:b4galt5 / 549139 XenbaseID:XB-GENE-982971 Length:384 Species:Xenopus tropicalis


Alignment Length:291 Identity:105/291 - (36%)
Similarity:165/291 - (56%) Gaps:27/291 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 TSIPQDLTRFLLGTKKFLPPRQKSTSALLANCTDPDPRDGGPITPN-TTLESLDVIEAELGPLLR 167
            |.:|:|.|        :||.:         :|.:..|...|.:..| :.::..||.:......::
 Frog    97 TFLPEDFT--------YLPNQ---------SCPERLPSMKGQMEVNMSEIQMSDVRQMFANGGIQ 144

  Fly   168 PGGAFEPENCNAQHHVAIVVPFRDRYAHLLLFLRNIHPFLMKQRIAYRIFIVEQTNGKPFNRAAM 232
            .||.::|.:|..:..|||::|||:|:.||.:..:::.|.|.:||:.:..::|||...:|||||.:
 Frog   145 MGGHWKPSDCIPRWKVAILIPFRNRHEHLPVLFKHLIPMLQRQRLQFAFYVVEQAGNQPFNRAML 209

  Fly   233 MNIGYLEALKLYQWDCFIFHDVDLLPLDDRNLYNCPRQPRHMSVAIDTLNFRLPYRSIFGGVSAM 297
            .|:|:|||:|...|||.||||||.:|..|||.|.|...|||.:..:|...:.|||...|||||.:
 Frog   210 FNVGFLEAMKDLDWDCLIFHDVDHIPESDRNYYGCEHMPRHFAAKLDKYMYLLPYNEFFGGVSGL 274

  Fly   298 TREHFQAVNGFSNSFFGWGGEDDDMSNRLKHANLFISRYPVNIARYKML--KHQKEKANPKRYEN 360
            |.|.|:.:|||.|:|:||||||||:.||:::|...::|...:|.:||.:  .|:.|.....||..
 Frog   275 TVEQFRKINGFPNAFWGWGGEDDDLWNRVQYAGYTVTRPEGDIGKYKSIPHHHRGEVQFLGRYAL 339

  Fly   361 LQNGMSKIEQDGINSIKYSIYSIKQFPTFTW 391
            |:....:...||:|::.||       |..|:
 Frog   340 LRRSKERQTMDGLNNLNYS-------PNITY 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beta4GalNAcTANP_610946.1 b4GalT 181..395 CDD:132999 89/213 (42%)
b4galt5NP_001016385.1 b4GalT 157..373 CDD:132999 89/214 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 91 1.000 Domainoid score I7542
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1201618at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.