DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beta4GalNAcTA and b4galt7

DIOPT Version :9

Sequence 1:NP_610946.1 Gene:beta4GalNAcTA / 36585 FlyBaseID:FBgn0027538 Length:403 Species:Drosophila melanogaster
Sequence 2:XP_021336677.1 Gene:b4galt7 / 445022 ZFINID:ZDB-GENE-040727-3 Length:328 Species:Danio rerio


Alignment Length:212 Identity:77/212 - (36%)
Similarity:125/212 - (58%) Gaps:12/212 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   181 HHVAIVVPFRDRYAHLLLFLRNIHPFLMKQRIAYRIFIVEQTNGKPFNRAAMMNIGYLEALKLYQ 245
            |.:|::||||:|:..||:|:..:|.||.|::|.::|||:.|.:...||||:::|:|::|:..  .
Zfish    94 HKMALIVPFRERFEELLVFVPYMHAFLNKKKIRHKIFIINQVDHFRFNRASLINVGFMESGN--D 156

  Fly   246 WDCFIFHDVDLLPLDDRNLYNCPRQ-PRHMSVAIDTLNFRLPYRSIFGGVSAMTREHFQAVNGFS 309
            .|....|||||||.::...|..|.. |.|  ||...|:....|::..||:..:|::|:.|.||.|
Zfish   157 TDYIAMHDVDLLPQNEDLNYGFPVDGPFH--VASPELHPLYHYKTYVGGILLLTKKHYLACNGMS 219

  Fly   310 NSFFGWGGEDDDMSNRLKHANLFISRYPVNIAR-YKMLKHQKE----KANPKRYENLQNGMSKIE 369
            |.|:|||.|||:...|||.|||.:.| |..|.. .|..:|..:    |.:.||....:....|::
Zfish   220 NRFWGWGREDDEFFRRLKAANLELFR-PTGITTGTKTFRHIHDPAWRKRDQKRIAAQKQEQFKVD 283

  Fly   370 -QDGINSIKYSIYSIKQ 385
             :.|:::::|.:.|.|:
Zfish   284 PEGGLSNLRYKVESRKE 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beta4GalNAcTANP_610946.1 b4GalT 181..395 CDD:132999 77/212 (36%)
b4galt7XP_021336677.1 b4GalT 93..316 CDD:132999 77/212 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1201618at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.