DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beta4GalNAcTA and beta4GalNAcTB

DIOPT Version :9

Sequence 1:NP_610946.1 Gene:beta4GalNAcTA / 36585 FlyBaseID:FBgn0027538 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_651657.1 Gene:beta4GalNAcTB / 43425 FlyBaseID:FBgn0039625 Length:323 Species:Drosophila melanogaster


Alignment Length:233 Identity:106/233 - (45%)
Similarity:147/233 - (63%) Gaps:1/233 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 GPLLRPGGAFEPENCNAQHHVAIVVPFRDRYAHLLLFLRNIHPFLMKQRIAYRIFIVEQTNGKPF 227
            |..:||||.|.||.|.|::..||:||:|.|...|..||..:|.:|.:|.|.||||:|||.:.|||
  Fly    91 GAEIRPGGEFRPEGCQARYSTAIIVPYRQREEQLHAFLTYMHNYLPQQLIHYRIFLVEQFDHKPF 155

  Fly   228 NRAAMMNIGYLEALKLYQWDCFIFHDVDLLPLDDRNLYNCPRQPRHMSVAIDTLNFRLPYRSIFG 292
            |||.:.|||...|.: |.:.|.|.||||||||:...:|.|..:|||||.|:|...||||||.:||
  Fly   156 NRAMLFNIGAQVAAE-YGFPCLILHDVDLLPLNSGQIYACSERPRHMSSALDHWRFRLPYRGLFG 219

  Fly   293 GVSAMTREHFQAVNGFSNSFFGWGGEDDDMSNRLKHANLFISRYPVNIARYKMLKHQKEKANPKR 357
            ||.|:....:|.:||.||.::||||||||:..||:..|:.|.|:.:..::|.||||::|:.|..|
  Fly   220 GVVAINTAQYQQINGMSNLYYGWGGEDDDLYERLQALNIDICRFAMEFSKYTMLKHKQEQPNANR 284

  Fly   358 YENLQNGMSKIEQDGINSIKYSIYSIKQFPTFTWYLAE 395
            ...|::...:...||:||:.|:....:....||..|.:
  Fly   285 VALLRSATLRQHADGLNSLVYTEMERRMHSLFTHILVD 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beta4GalNAcTANP_610946.1 b4GalT 181..395 CDD:132999 96/213 (45%)
beta4GalNAcTBNP_651657.1 b4GalT 108..322 CDD:132999 96/214 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3916
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1201618at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19300
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.