DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beta4GalNAcTA and beta4GalT7

DIOPT Version :9

Sequence 1:NP_610946.1 Gene:beta4GalNAcTA / 36585 FlyBaseID:FBgn0027538 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_651319.2 Gene:beta4GalT7 / 42991 FlyBaseID:FBgn0039258 Length:322 Species:Drosophila melanogaster


Alignment Length:246 Identity:81/246 - (32%)
Similarity:134/246 - (54%) Gaps:25/246 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 ESLDVIEAELGPLLRPGGAFEPENCNAQ-HHVAIVVPFRDRYAHLLLFLRNIHPFLMKQRIAYRI 216
            |.:.||:.|.....:|    :|.:..|. |.:|::||||||:..||.|:.::..||.:|.:|:.|
  Fly    50 EGVSVIKKEPADEKQP----QPHDHGASVHKMALLVPFRDRFEELLQFVPHMTAFLKRQGVAHHI 110

  Fly   217 FIVEQTNGKPFNRAAMMNIGYLEALKLYQWDCFIFHDVDLLPLDDRNLYNCPRQPRHMSVAIDTL 281
            |::.|.:...||||:::|:|:..|..:|  |....||||||||:|..||..|.....:.:|...|
  Fly   111 FVLNQVDRFRFNRASLINVGFQFASDVY--DYIAMHDVDLLPLNDNLLYEYPSSLGPLHIAGPKL 173

  Fly   282 NFRLPYRSIFGGVSAMTREHFQAVNGFSNSFFGWGGEDDDMSNRLKHANLFISRYPVNIA----- 341
            :.:..|.:..||:..:.||||:.:||.||.::|||.|||:...|::.|.|.::| |.||.     
  Fly   174 HPKYHYDNFVGGILLVRREHFKQMNGMSNQYWGWGLEDDEFFVRIRDAGLQVTR-PQNIKTGTND 237

  Fly   342 -------RYKMLKHQKEKANPKRYENLQNGMSKIEQDGINSIKYSIYSIKQ 385
                   ||    |:| :...|.:...:....:..:.|::::||.|..:.:
  Fly   238 TFSHIHNRY----HRK-RDTQKCFNQKEMTRKRDHKTGLDNVKYKILKVHE 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beta4GalNAcTANP_610946.1 b4GalT 181..395 CDD:132999 74/217 (34%)
beta4GalT7NP_651319.2 b4GalT 75..299 CDD:132999 74/217 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452036
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1201618at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19300
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.