DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beta4GalNAcTA and B4galt7

DIOPT Version :9

Sequence 1:NP_610946.1 Gene:beta4GalNAcTA / 36585 FlyBaseID:FBgn0027538 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_666157.1 Gene:B4galt7 / 218271 MGIID:2384987 Length:327 Species:Mus musculus


Alignment Length:222 Identity:78/222 - (35%)
Similarity:129/222 - (58%) Gaps:12/222 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 PGGAFEPENCNAQHHVAIVVPFRDRYAHLLLFLRNIHPFLMKQRIAYRIFIVEQTNGKPFNRAAM 232
            |...:|.:.....|.:|::||||:|:..||:|:.::|.||.::||.:.|:::.|.:...|||||:
Mouse    80 PPEHWEEDESWGPHRLAVLVPFRERFEELLVFVPHMHRFLSRKRIQHHIYVLNQVDHFRFNRAAL 144

  Fly   233 MNIGYLEALKLYQWDCFIFHDVDLLPLDDRNLYNCPRQ-PRHMSVAIDTLNFRLPYRSIFGGVSA 296
            :|:|:||:..  ..|....||||||||::...|..|.. |.|  ||...|:....|::..||:..
Mouse   145 INVGFLESSN--STDYIAMHDVDLLPLNEELDYGFPEAGPFH--VASPELHPLYHYKTYVGGILL 205

  Fly   297 MTREHFQAVNGFSNSFFGWGGEDDDMSNRLKHANLFISRYPVNIAR-YKMLKHQKE----KANPK 356
            ::::|:|..||.||.|:|||.|||:...|:|.|.|.:.| |..|.. |:..:|..:    |.:.|
Mouse   206 LSKQHYQLCNGMSNRFWGWGREDDEFYRRIKGAGLQLFR-PSGITTGYQTFRHLHDPAWRKRDQK 269

  Fly   357 RYENLQNGMSKIEQD-GINSIKYSIYS 382
            |....:....|:::: |:|::||.:.|
Mouse   270 RIAAQKQEQFKVDREGGLNTVKYRVDS 296

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
beta4GalNAcTANP_610946.1 b4GalT 181..395 CDD:132999 76/209 (36%)
B4galt7NP_666157.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 61..88 2/7 (29%)
b4GalT 92..315 CDD:132999 76/210 (36%)
UDP-alpha-D-galactose binding. /evidence=ECO:0000250|UniProtKB:Q9UBV7 100..104 3/3 (100%)
UDP-alpha-D-galactose binding. /evidence=ECO:0000250|UniProtKB:Q9UBV7 139..141 1/1 (100%)