DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beta4GalNAcTA and sqv-3

DIOPT Version :9

Sequence 1:NP_610946.1 Gene:beta4GalNAcTA / 36585 FlyBaseID:FBgn0027538 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_499164.1 Gene:sqv-3 / 176382 WormBaseID:WBGene00005021 Length:289 Species:Caenorhabditis elegans


Alignment Length:211 Identity:62/211 - (29%)
Similarity:111/211 - (52%) Gaps:11/211 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   181 HHVAIVVPFRDRYAHLLLFLRNIHPFLMKQRIAYRIFIVEQTNGKPFNRAAMMNIGYLEALKLYQ 245
            |.:.::||:|||...|..|..::..||..|.:::.|.|:.||:...||||:::|:|:.||.:| .
 Worm    51 HKLCVIVPYRDRLEELREFSPHMSKFLHNQNVSHHILIINQTDPLRFNRASLINVGWNEADRL-G 114

  Fly   246 WDCFIFHDVDLLPLDDRNLYNCPRQPRHMSVAIDTLNFRLPYRSIFGGVSAMTREHFQAVNGFSN 310
            .|..:.:||||||::....|:.|.......:.....:.:..|....||:..:|.:.::.:||.||
 Worm   115 CDYMVMNDVDLLPVNPEVPYDFPGIGVIRHITSPQYHPKYHYEKFIGGILMLTLKDYKKLNGMSN 179

  Fly   311 SFFGWGGEDDDMSNRLKHANLFISRY------PVNIARYKMLKHQKEKANPKRYENLQNGMSKIE 369
            .::|||.|||:...|:..:.|.::|.      ..|..|:.....:|....||:.:..|..: |.:
 Worm   180 KYWGWGLEDDEFYLRIIDSKLNLTRVSGLSTDSSNTFRHIHGPKRKRDYTPKKNDKNQWEI-KRK 243

  Fly   370 QD---GINSIKYSIYS 382
            :|   |::.::|.|.|
 Worm   244 RDHVSGLHDVRYLIDS 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beta4GalNAcTANP_610946.1 b4GalT 181..395 CDD:132999 62/211 (29%)
sqv-3NP_499164.1 b4GalT 50..278 CDD:132999 62/211 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1201618at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.