DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beta4GalNAcTA and b4galt3

DIOPT Version :9

Sequence 1:NP_610946.1 Gene:beta4GalNAcTA / 36585 FlyBaseID:FBgn0027538 Length:403 Species:Drosophila melanogaster
Sequence 2:XP_031747171.1 Gene:b4galt3 / 100486704 XenbaseID:XB-GENE-22252019 Length:467 Species:Xenopus tropicalis


Alignment Length:268 Identity:111/268 - (41%)
Similarity:164/268 - (61%) Gaps:12/268 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 LLANCTDPDPRDGGPI----TPNTTLESLDVIEAELGPLLRPGGAFEPENCNAQHHVAIVVPFRD 191
            ||..|.:..|...|||    |.|.||:.:.    :..||:..||.::|.||.|:|..||::|.|:
 Frog    74 LLPRCPERSPYLVGPISVTFTQNPTLKKVQ----DKNPLVTRGGEYKPPNCEARHRTAIIIPHRN 134

  Fly   192 RYAHLLLFLRNIHPFLMKQRIAYRIFIVEQTNGKPFNRAAMMNIGYLEALKLYQWDCFIFHDVDL 256
            |..||...|..:||||.:|::.|||:|:.|.....||||.::|:|..|||:..:|||...|||||
 Frog   135 RETHLRHLLYYLHPFLQRQQLHYRIYIINQAGNATFNRAKLLNVGVKEALRDEEWDCLFLHDVDL 199

  Fly   257 LPLDDRNLYNC-PRQPRHMSVAIDTLNFRLPYRSIFGGVSAMTREHFQAVNGFSNSFFGWGGEDD 320
            :|.:|.|||.| |..|:|.|||::..::.|||...||||||:|.:.:..:|||.|.::|||||||
 Frog   200 IPENDYNLYVCDPWNPKHASVAMNKFSYSLPYPQYFGGVSALTPDQYMKMNGFPNEYWGWGGEDD 264

  Fly   321 DMSNRLKHANLFISRYPVNIARYKMLKH---QKEKANPKRYENLQNGMSKIEQDGINSIKYSIYS 382
            |::.|::.|.:.|:|..|::..|||:||   |..:.||.|::.|.......:.||:||:.|::..
 Frog   265 DIATRVRLAGMKITRPSVSVGHYKMVKHKVDQGNEENPHRFDLLIRTQRMWKADGMNSLTYTLLE 329

  Fly   383 IKQFPTFT 390
            ....|.:|
 Frog   330 RALEPLYT 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beta4GalNAcTANP_610946.1 b4GalT 181..395 CDD:132999 92/214 (43%)
b4galt3XP_031747171.1 b4GalT 123..342 CDD:132999 92/215 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 128 1.000 Domainoid score I5217
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 243 1.000 Inparanoid score I3225
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1201618at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm49006
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X405
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.060

Return to query results.
Submit another query.