DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8531 and DNAJC5B

DIOPT Version :9

Sequence 1:NP_610945.1 Gene:CG8531 / 36584 FlyBaseID:FBgn0033918 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_001336361.1 Gene:DNAJC5B / 85479 HGNCID:24138 Length:199 Species:Homo sapiens


Alignment Length:74 Identity:28/74 - (37%)
Similarity:38/74 - (51%) Gaps:3/74 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 ENYYTFLNLPRDATAEQINTAYRKQSRMFHPDKHLDPDSKKMAEIMFNRTKRAYEVLSDPQQRAI 78
            |..|..|.|.:.|:.|:|...|||.:...||||  :||.....| .|.....|:.:|:|..:|:|
Human    18 EALYEILGLHKGASNEEIKKTYRKLALKHHPDK--NPDDPAATE-KFKEINNAHAILTDISKRSI 79

  Fly    79 YDSVGEKGL 87
            ||..|..||
Human    80 YDKYGSLGL 88

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8531NP_610945.1 DnaJ 15..>91 CDD:223560 27/73 (37%)
DnaJ 15..80 CDD:278647 22/64 (34%)
DUF3395 409..538 CDD:288708
DNAJC5BNP_001336361.1 PRK10767 21..>84 CDD:236757 24/65 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.