DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8531 and dnajb14

DIOPT Version :9

Sequence 1:NP_610945.1 Gene:CG8531 / 36584 FlyBaseID:FBgn0033918 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_001071255.1 Gene:dnajb14 / 792752 ZFINID:ZDB-GENE-061110-138 Length:380 Species:Danio rerio


Alignment Length:101 Identity:33/101 - (32%)
Similarity:54/101 - (53%) Gaps:15/101 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 ENYYTFLNLPRDATAEQINTAYRKQSRMFHPDKHLDPDSKKMAEIMFNRTKRAYEVLSDPQQRAI 78
            :|||..|.:.:||:.:::..|||:.:..|||||:..|.    |...|.:...||.|||:|:::..
Zfish   110 KNYYEVLGIRKDASDDELKKAYRQLALKFHPDKNHAPG----ATDAFKKIGNAYSVLSNPEKKRQ 170

  Fly    79 YDSVGEKGLRT------EGWEILHR----TKTPDEI 104
            ||..|.:...|      ||:: .||    ..||:::
Zfish   171 YDLSGGEEPSTPNYSSHEGFD-FHRGFESDITPEDL 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8531NP_610945.1 DnaJ 15..>91 CDD:223560 27/81 (33%)
DnaJ 15..80 CDD:278647 23/64 (36%)
DUF3395 409..538 CDD:288708
dnajb14NP_001071255.1 DnaJ 110..>218 CDD:223560 33/101 (33%)
DnaJ 111..172 CDD:278647 23/64 (36%)
DUF1977 272..372 CDD:286411
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.