DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8531 and Dnajb14

DIOPT Version :9

Sequence 1:NP_610945.1 Gene:CG8531 / 36584 FlyBaseID:FBgn0033918 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_001028327.1 Gene:Dnajb14 / 70604 MGIID:1917854 Length:379 Species:Mus musculus


Alignment Length:181 Identity:44/181 - (24%)
Similarity:65/181 - (35%) Gaps:71/181 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 ENYYTFLNLPRDATAEQINTAYRKQSRMFHPDKHLDPDSKKMAEIMFNRTKRAYEVLSDPQQRAI 78
            :|||..|.:.:||..|.:..||||.:..|||||:..|.    |...|.:...||.|||:|::|..
Mouse   107 KNYYEVLGVTKDAGDEDLKKAYRKLALKFHPDKNHAPG----ATDAFKKIGNAYAVLSNPEKRKQ 167

  Fly    79 YDSVGEKGLRTEGWEILHRTKTPDEIREEYERLAQAAAERRLQQRTNPRGNITINVNATEIFAPY 143
            ||..|.:                                   :|..|.:.|              
Mouse   168 YDLTGSE-----------------------------------EQACNHQNN-------------- 183

  Fly   144 DDSEMPHVEIGSMSIAQSIEAPITRKDMI-------IMSGNLYS-SNGNGS 186
                      |..:..:..||.||.:|:.       ..||:::| |||..:
Mouse   184 ----------GRFNFHRGCEADITPEDLFNIFFGGGFPSGSVHSFSNGRAA 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8531NP_610945.1 DnaJ 15..>91 CDD:223560 29/75 (39%)
DnaJ 15..80 CDD:278647 26/64 (41%)
DUF3395 409..538 CDD:288708
Dnajb14NP_001028327.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 56..90
DnaJ 107..>214 CDD:223560 39/169 (23%)
DnaJ 108..169 CDD:278647 26/64 (41%)
DUF1977 271..371 CDD:286411
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.