DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8531 and Dnajb7

DIOPT Version :9

Sequence 1:NP_610945.1 Gene:CG8531 / 36584 FlyBaseID:FBgn0033918 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_001123982.1 Gene:Dnajb7 / 685839 RGDID:1589047 Length:303 Species:Rattus norvegicus


Alignment Length:309 Identity:76/309 - (24%)
Similarity:111/309 - (35%) Gaps:73/309 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 NYYTFLNLPRDATAEQINTAYRKQSRMFHPDKHLDPDSKKMAEIMFNRTKRAYEVLSDPQQRAIY 79
            :||..|.:.|.|:.|.|..||||.:..:||||  :|::|:.||..|.....||||||:.::|.||
  Rat     3 DYYEVLGVQRYASPEDIKRAYRKVALKWHPDK--NPENKEEAERKFKEVAEAYEVLSNGEKRDIY 65

  Fly    80 DSVGEKGLRTEGWEILHR--------TKTPDEIREEY------------ERLAQAAAERRLQQRT 124
            |..|::||...|...|..        .|..|..:|.:            :.||...:..|....:
  Rat    66 DKYGKEGLTGGGGSHLDDEREYGFTFRKADDVFKEIFGERDPFSFHFFEDSLADLLSSSRSSSGS 130

  Fly   125 NPRGNITINVNATEIFA---PYDDSEMPHVEIGSMSIAQ----SIEAPITRKDMIIMSGNLYSSN 182
            ..||::........:||   .||....|:|..|..|:..    :.|.|                 
  Rat   131 RSRGSLFSRSYDYPVFARLSSYDTGYSPYVSRGHESLTSVSSLAFEDP----------------- 178

  Fly   183 GNGSGGFVIAGRRLLNKGWIELCAGAGNGFLLGLKGGRTLSQKLTLNGGTNLNFRDQGVIPALFS 247
              |.|.::.....::|                    ||.:..|.|..........|...:.:...
  Rat   179 --GVGNYIPITPSVIN--------------------GRNVKTKKTFENRQERKVEDDSELRSFLV 221

  Fly   248 TLAVQLDKHTMGSLTLNAGSQSSMSTQIDHSKET-YSLSSSLVIGTPHV 295
            ......||......:.|..|.:|.:    ||..| |||......|||.|
  Rat   222 NEEGFADKCNWRRQSFNDYSPNSYT----HSSTTQYSLVDDKEQGTPWV 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8531NP_610945.1 DnaJ 15..>91 CDD:223560 33/75 (44%)
DnaJ 15..80 CDD:278647 28/64 (44%)
DUF3395 409..538 CDD:288708
Dnajb7NP_001123982.1 DnaJ 3..66 CDD:278647 28/64 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.