DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8531 and zgc:122979

DIOPT Version :9

Sequence 1:NP_610945.1 Gene:CG8531 / 36584 FlyBaseID:FBgn0033918 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_001032663.2 Gene:zgc:122979 / 641576 ZFINID:ZDB-GENE-051127-45 Length:360 Species:Danio rerio


Alignment Length:396 Identity:88/396 - (22%)
Similarity:147/396 - (37%) Gaps:129/396 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 NYYTFLNLPRDATAEQINTAYRKQSRMFHPDKHLDPDSKKMAEIMFNRTKRAYEVLSDPQQRAIY 79
            :||:.|.:..|:..|:|..||::.:..:||||:.|.|    ||..|.:..:||:||:||::|.||
Zfish    51 DYYSVLGVSNDSNEEEIRKAYKRLALRYHPDKNSDAD----AEDKFKQIAQAYDVLTDPEKRNIY 111

  Fly    80 DSVGEKGLRTEGWEILHRTKTPDEIREEYERLAQAAAERRLQQRTNPRGNITINVNATEIFAPYD 144
            |   ::||...|                   :|...      .:|:|..|...:.::..:|..:|
Zfish   112 D---QQGLTKGG-------------------VAPTC------NKTDPSHNSKADAHSWHMFFNFD 148

  Fly   145 -DSEMPHVEIGSMSIAQSIEAPITRKDMIIMSGNLYSSNGNGSGGFVIAGRRLLNKGWIELCAGA 208
             ||:            ..:..|.||..:    .:|...:|| .||...||...::...:.|    
Zfish   149 LDSD------------DDLFNPFTRNPL----PHLSRHHGN-KGGLKPAGDAEVHDLSVSL---- 192

  Fly   209 GNGFLLGLKGGRTLSQKLTLNGGTNLNFRDQGVIPALFSTLAVQLDKHTMG------SLTLNAGS 267
             ...|:|:    |...|||       ..|              |.||||:.      .:.:..|.
Zfish   193 -EDILMGV----TKRVKLT-------RLR--------------QTDKHTLKPEERVFDVEVKKGW 231

  Fly   268 QSSMSTQIDHSKETYSL-------SSSLVIGTPHVYF-----GLSYTRKMMENELKLKLAAKVGT 320
            :.  .|:|....|.:.:       .:.::....|.:|     .:.||..:...|........|.|
Zfish   232 KE--GTRITFPNEGHQMLGHAPNDLAFVIKEKKHAHFRRDGSHIVYTCTITLREALCGCTVNVPT 294

  Fly   321 FGFMGEYGVEK-----KVSKYSSVTATVSIGVP--------SGVILKFKILRSNQSYVFPIHLSD 372
            ..     |..|     .|.|.|||...:..|:|        ..::::|::       |||    |
Zfish   295 LD-----GQMKPLPCSDVIKPSSVRRLIGEGLPRAKNPAQRGDLLVEFQV-------VFP----D 343

  Fly   373 EIVPAA 378
            .|.|::
Zfish   344 RIPPSS 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8531NP_610945.1 DnaJ 15..>91 CDD:223560 29/75 (39%)
DnaJ 15..80 CDD:278647 25/64 (39%)
DUF3395 409..538 CDD:288708
zgc:122979NP_001032663.2 DnaJ 50..355 CDD:223560 88/396 (22%)
DnaJ 51..112 CDD:278647 25/64 (39%)
DnaJ_C 185..345 CDD:199909 38/207 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.