DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8531 and Dnajb12

DIOPT Version :9

Sequence 1:NP_610945.1 Gene:CG8531 / 36584 FlyBaseID:FBgn0033918 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_001361685.1 Gene:Dnajb12 / 56709 MGIID:1931881 Length:378 Species:Mus musculus


Alignment Length:71 Identity:27/71 - (38%)
Similarity:40/71 - (56%) Gaps:4/71 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 ENYYTFLNLPRDATAEQINTAYRKQSRMFHPDKHLDPDSKKMAEIMFNRTKRAYEVLSDPQQRAI 78
            ::||..|.:.|.|:.|.:..||||.:..|||||:..|.:.:    .|.....||.|||:|::|..
Mouse   110 KDYYEILGVSRSASDEDLKKAYRKLALKFHPDKNHAPGATE----AFKAIGTAYAVLSNPEKRKQ 170

  Fly    79 YDSVGE 84
            ||..|:
Mouse   171 YDQFGD 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8531NP_610945.1 DnaJ 15..>91 CDD:223560 27/70 (39%)
DnaJ 15..80 CDD:278647 24/64 (38%)
DUF3395 409..538 CDD:288708
Dnajb12NP_001361685.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 45..97
DnaJ_bact 111..>237 CDD:274090 27/70 (39%)
DUF1977 269..369 CDD:370429
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.