Sequence 1: | NP_610945.1 | Gene: | CG8531 / 36584 | FlyBaseID: | FBgn0033918 | Length: | 545 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_064348.1 | Gene: | Dnajb8 / 56691 | MGIID: | 1922801 | Length: | 227 | Species: | Mus musculus |
Alignment Length: | 222 | Identity: | 63/222 - (28%) |
---|---|---|---|
Similarity: | 91/222 - (40%) | Gaps: | 60/222 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 15 NYYTFLNLPRDATAEQINTAYRKQSRMFHPDKHLDPDSKKMAEIMFNRTKRAYEVLSDPQQRAIY 79
Fly 80 DSVG-EKGLRTEGWEILHRT--------KTPDEI-REEYERLAQAAAE---RRLQQRTNPRGNIT 131
Fly 132 INVNATEIFAPYDDSEMP-HVEI-----------GSMSIAQSIEAPITRKDMIIMSGNLYSSNGN 184
Fly 185 GSGGF--------VIAGRRLLNKGWIE 203 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG8531 | NP_610945.1 | DnaJ | 15..>91 | CDD:223560 | 32/76 (42%) |
DnaJ | 15..80 | CDD:278647 | 29/64 (45%) | ||
DUF3395 | 409..538 | CDD:288708 | |||
Dnajb8 | NP_064348.1 | DnaJ | 3..66 | CDD:278647 | 29/64 (45%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |