DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG8531 and DNAJC3

DIOPT Version :9

Sequence 1:	NP_610945.1	Gene:	CG8531 / 36584	FlyBaseID:	FBgn0033918	Length:	545	Species:	Drosophila melanogaster
Sequence 2:	XP_011519406.1	Gene:	DNAJC3 / 5611	HGNCID:	9439	Length:	533	Species:	Homo sapiens

Alignment Length:	117	Identity:	39/117 - (33%)
Similarity:	56/117 - (47%)	Gaps:	21/117 - (17%)

- Green bases have known domain annotations that are detailed below.

  Fly     2 ASDHDESDAELDE---------------NYYTFLNLPRDATAEQINTAYRKQSRMFHPDKHLDPD 51
            |.:|:|:|.::.|               :||..|.:.|:|..::|..||||.:..:|||...:.:
Human   395 AQEHNENDQQIREGLEKAQRLLKQSQKRDYYKILGVKRNAKKQEIIKAYRKLALQWHPDNFQNEE 459

  Fly    52 SKKMAEIMFNRTKRAYEVLSDPQQRAIYDSVGEKGLRTE-----GWEILHRT 98
            .||.||..|.....|.||||||:.|..:|. ||..|..|     |....||:
Human   460 EKKKAEKKFIDIAAAKEVLSDPEMRKKFDD-GEDPLDAESQQGGGGNPFHRS 510

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG8531	NP_610945.1	DnaJ	15..>91	CDD:223560	31/80 (39%)
		DnaJ	15..80	CDD:278647	26/64 (41%)
		DUF3395	409..538	CDD:288708
DNAJC3	XP_011519406.1	TPR_11	36..100	CDD:290150
		TPR repeat	37..65	CDD:276809
		TPR repeat	70..100	CDD:276809
		TPR_11	73..132	CDD:290150
		TPR repeat	105..132	CDD:276809
		TPR_11	182..246	CDD:290150
		TPR repeat	186..211	CDD:276809
		TPR_11	216..281	CDD:290150
		TPR repeat	216..246	CDD:276809
		TPR repeat	251..279	CDD:276809
		TPR repeat	285..309	CDD:276809
		TPR repeat	330..364	CDD:276809
		TPR_19	347..411	CDD:291240	5/15 (33%)
		TPR_1	369..402	CDD:278916	3/6 (50%)
		TPR repeat	369..397	CDD:276809	1/1 (100%)
		TPR repeat	403..426	CDD:276809	2/22 (9%)
		DnaJ	421..>527	CDD:223560	34/91 (37%)
		DnaJ	423..488	CDD:278647	26/64 (41%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910