DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8531 and CG10565

DIOPT Version :9

Sequence 1:NP_610945.1 Gene:CG8531 / 36584 FlyBaseID:FBgn0033918 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_001246856.1 Gene:CG10565 / 40332 FlyBaseID:FBgn0037051 Length:646 Species:Drosophila melanogaster


Alignment Length:108 Identity:27/108 - (25%)
Similarity:45/108 - (41%) Gaps:33/108 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DHDESDAEL---------------------DENYYTFLNLPR---DATAEQINTAYRKQSRMFHP 44
            :..|||.:|                     |:::|..|.|.:   :|:.:.:..|||:...:.||
  Fly    44 ERSESDEKLEGVGEEVDISYLKSLDPKEWKDQDHYAVLGLGKLRYEASEDDVRRAYRRMVLLHHP 108

  Fly    45 DKHLDPDSKKMAEIM-----FNRTKRAYEVLSDPQQRAIYDSV 82
            ||.    ..|..|::     |....:|||:|...:.|..:|||
  Fly   109 DKR----KAKGEEVIQDDDYFTCITKAYEILGTSKPRRSFDSV 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8531NP_610945.1 DnaJ 15..>91 CDD:223560 22/76 (29%)
DnaJ 15..80 CDD:278647 19/72 (26%)
DUF3395 409..538 CDD:288708
CG10565NP_001246856.1 CbpA 76..282 CDD:225124 22/76 (29%)
DnaJ 76..145 CDD:278647 19/72 (26%)
RILP-like 268..>344 CDD:304877
RAC_head 332..401 CDD:293322
SANT 584..633 CDD:197842
SANT 585..632 CDD:238096
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464394
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.