powered by:
Protein Alignment CG8531 and CG2790
DIOPT Version :9
Sequence 1: | NP_610945.1 |
Gene: | CG8531 / 36584 |
FlyBaseID: | FBgn0033918 |
Length: | 545 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_611986.2 |
Gene: | CG2790 / 37992 |
FlyBaseID: | FBgn0027599 |
Length: | 540 |
Species: | Drosophila melanogaster |
Alignment Length: | 73 |
Identity: | 34/73 - (46%) |
Similarity: | 46/73 - (63%) |
Gaps: | 2/73 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 16 YYTFLNLPRDATAEQINTAYRKQSRMFHPDKHLDPDSKKMAEIMFNRTKRAYEVLSDPQQRAIYD 80
||..|.|.|:|....|.:||||.:..:|||| :||....|:..|...::|||||||||:|:.||
Fly 4 YYEELELQRNANDGDIKSAYRKMALRWHPDK--NPDRLAEAKERFQLIQQAYEVLSDPQERSWYD 66
Fly 81 SVGEKGLR 88
:..|:.||
Fly 67 NHREQILR 74
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C45464392 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.