DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8531 and CG2790

DIOPT Version :9

Sequence 1:NP_610945.1 Gene:CG8531 / 36584 FlyBaseID:FBgn0033918 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_611986.2 Gene:CG2790 / 37992 FlyBaseID:FBgn0027599 Length:540 Species:Drosophila melanogaster


Alignment Length:73 Identity:34/73 - (46%)
Similarity:46/73 - (63%) Gaps:2/73 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 YYTFLNLPRDATAEQINTAYRKQSRMFHPDKHLDPDSKKMAEIMFNRTKRAYEVLSDPQQRAIYD 80
            ||..|.|.|:|....|.:||||.:..:||||  :||....|:..|...::|||||||||:|:.||
  Fly     4 YYEELELQRNANDGDIKSAYRKMALRWHPDK--NPDRLAEAKERFQLIQQAYEVLSDPQERSWYD 66

  Fly    81 SVGEKGLR 88
            :..|:.||
  Fly    67 NHREQILR 74

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8531NP_610945.1 DnaJ 15..>91 CDD:223560 34/73 (47%)
DnaJ 15..80 CDD:278647 29/63 (46%)
DUF3395 409..538 CDD:288708
CG2790NP_611986.2 DnaJ 3..66 CDD:278647 29/63 (46%)
ZUO1 19..>252 CDD:227594 28/58 (48%)
zf-C2H2_jaz 313..337 CDD:288983
C2H2 Zn finger 315..337 CDD:275371
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464392
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.