powered by:
Protein Alignment CG8531 and mrj
DIOPT Version :9
Sequence 1: | NP_610945.1 |
Gene: | CG8531 / 36584 |
FlyBaseID: | FBgn0033918 |
Length: | 545 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001246364.1 |
Gene: | mrj / 36797 |
FlyBaseID: | FBgn0034091 |
Length: | 346 |
Species: | Drosophila melanogaster |
Alignment Length: | 67 |
Identity: | 29/67 - (43%) |
Similarity: | 41/67 - (61%) |
Gaps: | 2/67 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 15 NYYTFLNLPRDATAEQINTAYRKQSRMFHPDKHLDPDSKKMAEIMFNRTKRAYEVLSDPQQRAIY 79
:||..|::.|.||..::..||||.:..:|||| :||:...|...|.....|||||||.::|.||
Fly 3 DYYKILDVSRSATDSEVKKAYRKLALKWHPDK--NPDNLDEANKRFRELSEAYEVLSDARKRRIY 65
Fly 80 DS 81
|:
Fly 66 DA 67
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.