DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8531 and Dnajc16

DIOPT Version :9

Sequence 1:NP_610945.1 Gene:CG8531 / 36584 FlyBaseID:FBgn0033918 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_001014216.1 Gene:Dnajc16 / 362652 RGDID:1359395 Length:771 Species:Rattus norvegicus


Alignment Length:505 Identity:102/505 - (20%)
Similarity:167/505 - (33%) Gaps:199/505 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ESDAELDENYYTFLNLPRDATAEQINTAYRKQSRMFHPDKHLDPDSKKMAEIMFNRTKRAYEVLS 71
            :|.:.||.:.|..|.:.|.|:...|..||:|.:|.:||||:.||.    ||..|.:..:|||:||
  Rat    21 QSLSALDFDPYRVLGVSRTASQADIKKAYKKLAREWHPDKNKDPG----AEDKFIQISKAYEILS 81

  Fly    72 DPQQRAIYDSVGEKGLRTEGWE-------------------------------------ILH--- 96
            :.::|..||..|:.| ..:|::                                     :||   
  Rat    82 NEEKRTNYDHYGDAG-ENQGYQQQREYRFRHFHENFYFDESFFHFPFNSERRDSIDEKYLLHFSH 145

  Fly    97 --RTKTPDEIREEYERLAQAAAERRLQQRTNPRGNITINVNATEIFAPYDDSEMPHVEIGSMSIA 159
              ....||..::.|                      .|.:.:...|:      ..|:|.....:.
  Rat   146 YVNEVVPDSFKKPY----------------------LIKITSDWCFS------CIHIEPIWKEVV 182

  Fly   160 QSIEAPITRKDMIIMSGNLYSSNGNGSG-GFVIAG--RRLLNKGWIELCAGA-GNGFLLGLKGGR 220
            |.:|                   |.|.| |.|.||  |||.:.      .|| ....:||:..| 
  Rat   183 QELE-------------------GLGVGIGVVHAGYERRLAHH------LGAHSTPSILGIING- 221

  Fly   221 TLSQKLTL--NGGTNLNFRD--QGVIPALFSTLAVQLDKHTMGSLTLNAGSQSSMSTQIDHSKET 281
                |::.  |...:.|.|.  :.::|               |:|.          .::.:....
  Rat   222 ----KISFFHNAVVHENLRQFVESLLP---------------GNLV----------EKVTNKNYV 257

  Fly   282 YSLSSSLVIGTPH-VYFGLSYTRKMMENELKLKLAA----KVGTFG--FMGEYGVEKKVSKYSSV 339
            ..||.......|| :.||.:....::     .||.|    ...:||  ::|..|||:...:|:  
  Rat   258 RFLSGWQQENKPHALLFGQTPAAPLL-----YKLTAFAYKDYVSFGYVYVGLRGVEEMTRQYN-- 315

  Fly   340 TATVSIGVPSGVILKFKILRSNQSYVFPIHLSDEIVPAAVFYASVTPVIAWFFIKRTVMDPMEAE 404
               |:|..|:.:|.|..|.:                ||....|.        .:|:.|::....:
  Rat   316 ---VNIYAPTMLIFKEHINK----------------PADAIQAR--------GLKKQVIEDFITQ 353

  Fly   405 RKNIEVER------------TKRQNEQRLSAKRHEASAAVHLMQATYNRI 442
            .|.:...|            .||.:.||        ...|.|:.|..|::
  Rat   354 NKYLLASRLTSQKLFHELCPVKRSHRQR--------KYCVVLLTAEANKL 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8531NP_610945.1 DnaJ 15..>91 CDD:223560 28/75 (37%)
DnaJ 15..80 CDD:278647 24/64 (38%)
DUF3395 409..538 CDD:288708 9/46 (20%)
Dnajc16NP_001014216.1 DnaJ 29..90 CDD:278647 24/64 (38%)
TRX_DnaJ 133..242 CDD:239261 30/166 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 559..590
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.