DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8531 and Dnajb1

DIOPT Version :9

Sequence 1:NP_610945.1 Gene:CG8531 / 36584 FlyBaseID:FBgn0033918 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_001382078.1 Gene:Dnajb1 / 361384 RGDID:1304725 Length:340 Species:Rattus norvegicus


Alignment Length:403 Identity:79/403 - (19%)
Similarity:128/403 - (31%) Gaps:178/403 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LDENYYTFLNLPRDATAEQINTAYRKQSRMFHPDKHLDPDSKKMAEIMFNRTKRAYEVLSDPQQR 76
            :.::||..|.|.|.|:.::|..|||:|:..:||||:.:|.    ||..|.....||:|||||::|
  Rat     1 MGKDYYQTLGLARGASDDEIKRAYRRQALRYHPDKNKEPG----AEEKFKEIAEAYDVLSDPRKR 61

  Fly    77 AIYDSVGEKGLRTEGWEILHRTKTPDEIREEYERLAQAAAERRLQQRTNPRGNITINVNATE--- 138
            .|:|..||:||:..|                                  |.|..:...|.|.   
  Rat    62 EIFDRYGEEGLKGGG----------------------------------PSGGSSGGANGTSFSY 92

  Fly   139 --------IFAPYDDSEMP--------HVEIGSMSIAQSIEAPITRKDMIIMSGNLYSSNGNGSG 187
                    :||.:.....|        :.|.|     ..|:.|             :||...|.|
  Rat    93 TFHGDPHAMFAEFFGGRNPFDTFFGQRNGEEG-----MDIDDP-------------FSSFPMGMG 139

  Fly   188 GFVIAGRRLLNKGWIELCAGAGNGFLLGLKGGRTLSQKLTLNGGTNLNFRDQGVIPALFSTLAVQ 252
            ||                                          ||:||                
  Rat   140 GF------------------------------------------TNMNF---------------- 146

  Fly   253 LDKHTMGSLTLNAGSQSSMSTQIDHSKETYSLSSSLVIGTPHVYFG------LSYTR-----KMM 306
                          .:|..:.:....|:...::..|.:....:|.|      :|:.|     |.:
  Rat   147 --------------GRSRPTQEPTRKKQDPPVTHDLRVSLEEIYSGCTKKMKISHKRLNPDGKSI 197

  Fly   307 ENE-----LKLKLAAKVGTFGFMGEYGVEKKVSKYSSVTATVSIGVPSGVILKFKILRSNQSYVF 366
            .||     :::|...|.||           |:: :.......|..:|:.::.   :|:.....:|
  Rat   198 RNEDKILTIEVKRGWKEGT-----------KIT-FPKEGDQTSNNIPADIVF---VLKDKPHNIF 247

  Fly   367 PIHLSDEIVPAAV 379
            ....||.|.||.:
  Rat   248 KRDGSDVIYPARI 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8531NP_610945.1 DnaJ 15..>91 CDD:223560 33/75 (44%)
DnaJ 15..80 CDD:278647 28/64 (44%)
DUF3395 409..538 CDD:288708
Dnajb1NP_001382078.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.