DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG8531 and Tpr2

DIOPT Version :9

Sequence 1:	NP_610945.1	Gene:	CG8531 / 36584	FlyBaseID:	FBgn0033918	Length:	545	Species:	Drosophila melanogaster
Sequence 2:	NP_001260501.1	Gene:	Tpr2 / 34984	FlyBaseID:	FBgn0032586	Length:	508	Species:	Drosophila melanogaster

Alignment Length:	70	Identity:	25/70 - (35%)
Similarity:	44/70 - (62%)	Gaps:	2/70 - (2%)

- Green bases have known domain annotations that are detailed below.

  Fly    14 ENYYTFLNLPRDATAEQINTAYRKQSRMFHPDKHLD--PDSKKMAEIMFNRTKRAYEVLSDPQQR 76
            ::||..|.:.|:|:.::|..||||::.:.|||:|.:  .:.:|..|:.|.....||.:|||..::
  Fly   401 KDYYKILGIGRNASDDEIKKAYRKKALVHHPDRHANSSAEERKEEELKFKEVGEAYAILSDAHKK 465

  Fly    77 AIYDS 81
            :.|||
  Fly   466 SRYDS 470

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG8531	NP_610945.1	DnaJ	15..>91	CDD:223560	25/69 (36%)
		DnaJ	15..80	CDD:278647	22/66 (33%)
		DUF3395	409..538	CDD:288708
Tpr2	NP_001260501.1	TPR_11	49..114	CDD:290150
		TPR repeat	49..77	CDD:276809
		TPR repeat	82..112	CDD:276809
		TPR_11	201..262	CDD:290150
		TPR repeat	201..225	CDD:276809
		TPR_1	231..264	CDD:278916
		TPR repeat	231..259	CDD:276809
		TPR_11	278..345	CDD:290150
		TPR repeat	310..344	CDD:276809
		TPR_11	314..380	CDD:290150
		TPR repeat	349..377	CDD:276809
		DnaJ	401..>503	CDD:223560	25/70 (36%)
		DnaJ	402..469	CDD:278647	22/66 (33%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C45464393
Domainoid	1	1.000	72	1.000	Domainoid score	I2208
eggNOG	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	3	2.840