powered by:
Protein Alignment CG8531 and Tpr2
DIOPT Version :9
Sequence 1: | NP_610945.1 |
Gene: | CG8531 / 36584 |
FlyBaseID: | FBgn0033918 |
Length: | 545 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001260501.1 |
Gene: | Tpr2 / 34984 |
FlyBaseID: | FBgn0032586 |
Length: | 508 |
Species: | Drosophila melanogaster |
Alignment Length: | 70 |
Identity: | 25/70 - (35%) |
Similarity: | 44/70 - (62%) |
Gaps: | 2/70 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 14 ENYYTFLNLPRDATAEQINTAYRKQSRMFHPDKHLD--PDSKKMAEIMFNRTKRAYEVLSDPQQR 76
::||..|.:.|:|:.::|..||||::.:.|||:|.: .:.:|..|:.|.....||.:|||..::
Fly 401 KDYYKILGIGRNASDDEIKKAYRKKALVHHPDRHANSSAEERKEEELKFKEVGEAYAILSDAHKK 465
Fly 77 AIYDS 81
:.|||
Fly 466 SRYDS 470
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C45464393 |
Domainoid |
1 |
1.000 |
72 |
1.000 |
Domainoid score |
I2208 |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.840 |
|
Return to query results.
Submit another query.