DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8531 and DnaJ-H

DIOPT Version :9

Sequence 1:NP_610945.1 Gene:CG8531 / 36584 FlyBaseID:FBgn0033918 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_001260431.1 Gene:DnaJ-H / 34707 FlyBaseID:FBgn0032474 Length:440 Species:Drosophila melanogaster


Alignment Length:481 Identity:110/481 - (22%)
Similarity:163/481 - (33%) Gaps:140/481 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 NYYTFLNLPRDATAEQINTAYRKQSRMFHPDKHLDPDS-KKMAEIMFNRTKRAYEVLSDPQQRAI 78
            |.|..|.:..|||.|:|...|||.::.|||||  :||: .|..||.|     ||||||||::|.|
  Fly     5 NLYDVLKVAPDATDEEIKKNYRKLAKEFHPDK--NPDAGDKFKEISF-----AYEVLSDPEKRRI 62

  Fly    79 YDSVGEKGLR--TEGWEILHRTKTPDEIRE------EYERLAQAAAERRLQQRTNPRGNITINVN 135
            ||..|.|||:  .||:         .:..|      .::|::.....||       .|.:.:.|.
  Fly    63 YDRYGLKGLQEGAEGF---------SDASEFFAQWFPFDRVSSEGRGRR-------NGKVVVKVE 111

  Fly   136 ATEIFAPYDDSEMPHVEIGSMSIAQSIEAPITRKDMIIMSGNLYSSNGNGSGGFVIAGRRLLNKG 200
            .|          :..:.:|.|            |..:..:.....|..||.||...|...     
  Fly   112 LT----------LEEIYVGGM------------KKKVEYNRQKLCSKCNGDGGPKEAHES----- 149

  Fly   201 WIELCAGAGNGFLLGLKGGRTLSQKLTLNGGTNLNFRD-------QG---VIPALFSTLAVQLD- 254
             .|.|.|||........|............|.....||       ||   |...:...|.|:.. 
  Fly   150 -CETCGGAGRAAAFTFMGLSPFDTTCPTCDGRGFTIRDDKKCSPCQGSGFVEQKMKRDLVVERGA 213

  Fly   255 KHTMGSLTLNAGSQ-------------SSMSTQIDHSKETYSLSSSLVIGTPHVYFGLSYTRKMM 306
            .|.:.....|.|.|             |.|...|...:........|.|.......|.|:..|.:
  Fly   214 PHMLKVPFANEGHQMRGGEFGDLIVVISQMEHPIFQRRHANLYMRDLEINITEALCGYSHCFKHL 278

  Fly   307 ENELKLKLAAKVGTFGFMGEYGVEKKVSKYSSVTATVSIGVP-------SG-VILKFKILRSNQS 363
            :..       .|....:.||      |.:::.:......|:|       || :.:|||:...:..
  Fly   279 DGR-------NVCLRTYPGE------VLQHNQIKMVRGSGMPVFNKATDSGDLYMKFKVKFPDND 330

  Fly   364 YVFPIHLS--DEIVPAAVFYASVTPVIAWFFIKRTVMDPMEAERKNIEVERT-----KRQNEQRL 421
            :.....|:  ::::|.                ::.::.|..||    ||:.|     .||.|...
  Fly   331 FATAPQLAMLEDLLPP----------------RQPIVIPKNAE----EVQMTDYKPQPRQQEDED 375

  Fly   422 SAKRH----EASAA----VHLMQATY 439
            ....|    :...|    :.|:||.|
  Fly   376 GQSSHFEGVQCQTAXCMWLWLLQARY 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8531NP_610945.1 DnaJ 15..>91 CDD:223560 38/78 (49%)
DnaJ 15..80 CDD:278647 32/65 (49%)
DUF3395 409..538 CDD:288708 12/44 (27%)
DnaJ-HNP_001260431.1 DnaJ 1..363 CDD:223560 100/441 (23%)
DnaJ 5..64 CDD:278647 32/65 (49%)
DnaJ_C 106..329 CDD:199909 48/263 (18%)
DnaJ_zf 134..197 CDD:199908 17/68 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003651
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.