DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8531 and Dnaja4

DIOPT Version :9

Sequence 1:NP_610945.1 Gene:CG8531 / 36584 FlyBaseID:FBgn0033918 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_001020582.1 Gene:Dnaja4 / 300721 RGDID:1310035 Length:555 Species:Rattus norvegicus


Alignment Length:471 Identity:101/471 - (21%)
Similarity:170/471 - (36%) Gaps:128/471 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ESDAELDE--------------NYYTFLNLPRDATAEQINTAYRKQSRMFHPDKHLDPDSKKMAE 57
            |||.:.:|              .||..|.:...|:.|:|..||||.:..:||||:.|...|    
  Rat   142 ESDGQPEEQTSEENGDKMVKETQYYDILGVKPSASPEEIKKAYRKLALKYHPDKNPDEGEK---- 202

  Fly    58 IMFNRTKRAYEVLSDPQQRAIYDSVGEKGLRTEGWEILHRTKTPDEIREEYERLAQAAAERRLQQ 122
              |....:||||||||::|.|||..||:.:: ||........:|.:|.:.:    .....|..::
  Rat   203 --FKLISQAYEVLSDPKKRDIYDQGGEQAIK-EGGSGSPSFSSPMDIFDMF----FGGGGRMTRE 260

  Fly   123 RTNPRG-NITINVNATEIFAPYDDSEMPHVEIGSMSIAQSIEAPITRKDMIIMSGNLYSSNGNGS 186
            |   || |:...::.|                     .:.:...||:|  :.:..|:......|.
  Rat   261 R---RGKNVVHQLSVT---------------------LEDLYNGITKK--LALQKNIICEKCEGI 299

  Fly   187 GGFVIAGRRLLNKGWIE---LCAGAGNGFLLGLKGGRTLSQKLTL-----NGGTNLNFRDQ---- 239
            ||         .||.:|   ||.|.|....:...|...:.|..|:     ..|..:|.:|:    
  Rat   300 GG---------KKGSVEKCPLCKGRGMQIHIQQIGPGMVQQIQTVCIECKGQGERINPKDRCEDC 355

  Fly   240 --GVIPALFSTLAVQLDK----------HTMGSL--TLNAGSQSSMSTQIDHS---KETYSLSSS 287
              ..:......:.|.:||          |..|..  .|..|....:..|.|||   :..:.|...
  Rat   356 SGAKVTREKKIIEVHVDKGMKDGQKILFHGEGDQEPELEPGDVIIVLDQKDHSVFQRRGHDLIMK 420

  Fly   288 LVIGTPHVYFGLSYTRKMMENELKLKLAAKVGTFGFMGEYGVEKKVSKYSSVTATVSIGVPSGVI 352
            :.|.......|...|.|.:::.: |.:::|.|            :|.|:..:....:.|:|    
  Rat   421 MKIQLSEALCGFKKTIKTLDDRV-LIISSKSG------------EVIKHGDLKCVRNEGMP---- 468

  Fly   353 LKFKILRSNQSYVFPIHLSDEIVPAAVFYASVTPVIAWFFIKR-----TVMDPMEAERKNIEVER 412
                      .|..|:.....|:...|    |.|...|..:::     .::.|.:..|...::::
  Rat   469 ----------IYKAPLEKGMLIIQFLV----VFPEKQWLSLEKLPQLEALLPPRQKVRITDDMDQ 519

  Fly   413 T--KRQNEQRLSAKRH 426
            .  |..|....|.::|
  Rat   520 VELKEFNPNEQSWRQH 535

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8531NP_610945.1 DnaJ 15..>91 CDD:223560 31/75 (41%)
DnaJ 15..80 CDD:278647 27/64 (42%)
DUF3395 409..538 CDD:288708 4/20 (20%)
Dnaja4NP_001020582.1 PTZ00037 144..552 CDD:240236 99/469 (21%)
DnaJ 165..223 CDD:278647 27/63 (43%)
DnaJ_C 264..490 CDD:199909 51/288 (18%)
DnaJ_zf 293..359 CDD:199908 16/74 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.