DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8531 and C47A4.1

DIOPT Version :9

Sequence 1:NP_610945.1 Gene:CG8531 / 36584 FlyBaseID:FBgn0033918 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_502648.2 Gene:C47A4.1 / 183525 WormBaseID:WBGene00008122 Length:157 Species:Caenorhabditis elegans


Alignment Length:85 Identity:21/85 - (24%)
Similarity:29/85 - (34%) Gaps:22/85 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   279 KETYSLSSSL-----VIGTPHVYFGLSYTRK----MMENELKLKL----------AAKVGTFGFM 324
            ||.|...:.|     .||...:.|...||.:    :.|.|..||.          ||:.......
 Worm    71 KEEYDDDAKLYLIRKYIGVSQMEFDQKYTDEDIDDLFERECWLKTNCATWKAERDAAEQEKMAQS 135

  Fly   325 GEYGVEKKVSKYSSVTATVS 344
            |.|   |:..:|.....|:|
 Worm   136 GRY---KRYKRYMKNAGTIS 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8531NP_610945.1 DnaJ 15..>91 CDD:223560
DnaJ 15..80 CDD:278647
DUF3395 409..538 CDD:288708
C47A4.1NP_502648.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164691
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.