DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8531 and dnj-7

DIOPT Version :9

Sequence 1:NP_610945.1 Gene:CG8531 / 36584 FlyBaseID:FBgn0033918 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_509209.1 Gene:dnj-7 / 180983 WormBaseID:WBGene00001025 Length:491 Species:Caenorhabditis elegans


Alignment Length:88 Identity:30/88 - (34%)
Similarity:44/88 - (50%) Gaps:11/88 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DHDESDAELD-----------ENYYTFLNLPRDATAEQINTAYRKQSRMFHPDKHLDPDSKKMAE 57
            ||.|:...|:           .:||..|.:.|:|:..:|..||||.::.:|||...|.:.||.||
 Worm   357 DHREAKEGLEHAKRLKTQAGKRDYYKILGVKRNASKREITKAYRKLAQKWHPDNFSDEEEKKKAE 421

  Fly    58 IMFNRTKRAYEVLSDPQQRAIYD 80
            ..|.....|.|||.|.::|..:|
 Worm   422 KKFIDIAAAKEVLQDEEKRRQFD 444

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG8531NP_610945.1 DnaJ 15..>91 CDD:223560 26/66 (39%)
DnaJ 15..80 CDD:278647 25/64 (39%)
DUF3395 409..538 CDD:288708
dnj-7NP_509209.1 TPR_11 29..91 CDD:290150
TPR repeat 29..54 CDD:276809
TPR repeat 59..89 CDD:276809
TPR_1 60..93 CDD:278916
TPR_11 61..124 CDD:290150
TPR 77..360 CDD:223533 2/2 (100%)
TPR repeat 94..121 CDD:276809
TPR repeat 140..168 CDD:276809
TPR repeat 173..203 CDD:276809
TPR repeat 208..236 CDD:276809
TPR repeat 324..354 CDD:276809