DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8531 and dnj-2

DIOPT Version :9

Sequence 1:NP_610945.1 Gene:CG8531 / 36584 FlyBaseID:FBgn0033918 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_502126.1 Gene:dnj-2 / 178043 WormBaseID:WBGene00001020 Length:337 Species:Caenorhabditis elegans


Alignment Length:366 Identity:82/366 - (22%)
Similarity:127/366 - (34%) Gaps:103/366 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 ENYYTFLNLPRDATAEQ-INTAYRKQSRMFHPDKHLDPDSKKMAEIMFNRTKRAYEVLSDPQQRA 77
            ||.|..|.:.|:...:| :..|||..:|..|||:..:.:.|.:||..|.....|||.|.|.:.:.
 Worm    35 ENCYDVLEVNREEFDKQKLAKAYRALARKHHPDRVKNKEEKLLAEERFRVIATAYETLKDDEAKT 99

  Fly    78 IYDSVGEKGLRTEGWEILHRTKTPDEIREEYERLAQAAAERRLQQRTNPRGNITINVNATEIFAP 142
            .||           :.:.|    ||:....|.:..:..|..::..|....|.|.|          
 Worm   100 NYD-----------YYLDH----PDQRFYNYYQYYRLRAAPKVDLRIVIVGTILI---------- 139

  Fly   143 YDDSEMPHVEIGSMSIAQSIEAPITRKDMIIMSGNLYSSNGNGSGGF-VIAGRRLLNKGWIELCA 206
                         :|:.|.:.|.....:.|        ....|.|.| .:|.:..::||.:|:  
 Worm   140 -------------ISLFQFLSAKHKFSEAI--------EYATGVGKFRNMAIKDGIDKGLLEM-- 181

  Fly   207 GAGNGFLLGLKG-------GRTLSQKLTLNGGTNLNFRDQGVIPALFSTLAVQLDKHT-MGSLTL 263
             ..||.|...||       .:.:...|.:.||....        :::.|||    .|| :..||:
 Worm   182 -DRNGKLKKNKGVDNDEVIKQIIIDNLDVTGGYKRE--------SIYDTLA----WHTIIFPLTI 233

  Fly   264 ------NAGSQSSMSTQIDHSKETYSLSSSL-----VIGTPHVYFGLSYTRK----MMENELKLK 313
                  .|......:.|    ||.|...:.|     .||...:.|...||.:    :.|.|..||
 Worm   234 FRYIKWTALWYWRFAIQ----KEEYDDDAKLYLIRKYIGVSQMEFDQKYTDEDIDDLFERECWLK 294

  Fly   314 L----------AAKVGTFGFMGEYGVEKKVSKYSSVTATVS 344
            .          ||:.......|.|   |:..:|.....|:|
 Worm   295 RNCATWKAERDAAEQEKMAQSGRY---KRYKRYMKNAGTIS 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8531NP_610945.1 DnaJ 15..>91 CDD:223560 23/76 (30%)
DnaJ 15..80 CDD:278647 21/65 (32%)
DUF3395 409..538 CDD:288708
dnj-2NP_502126.1 DnaJ 36..102 CDD:278647 21/65 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164692
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.