DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG8531 and dnj-28

DIOPT Version :9

Sequence 1:	NP_610945.1	Gene:	CG8531 / 36584	FlyBaseID:	FBgn0033918	Length:	545	Species:	Drosophila melanogaster
Sequence 2:	NP_491084.1	Gene:	dnj-28 / 171870	WormBaseID:	WBGene00001046	Length:	494	Species:	Caenorhabditis elegans

Alignment Length:	76	Identity:	29/76 - (38%)
Similarity:	43/76 - (56%)	Gaps:	1/76 - (1%)

- Green bases have known domain annotations that are detailed below.

  Fly    15 NYYTFLNLPRDATAEQINTAYRKQSRMFHPDKHLDPDSKKMAEIMFNRTKRAYEVLSDPQQRAIY 79
            :||..|.:.|:|...:|..||||.::.:|||...|...||.||..|.....|.||||:.::|..:
Worm   380 DYYKILGVRRNANKREITKAYRKMAQKWHPDNFQDEKEKKKAEKKFIDIAAAKEVLSNEEKRRAF 444

  Fly    80 DSVGEKGLRTE 90
            |: |:..|.:|
Worm   445 DN-GQDPLDSE 454

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG8531	NP_610945.1	DnaJ	15..>91	CDD:223560	29/76 (38%)
		DnaJ	15..80	CDD:278647	25/64 (39%)
		DUF3395	409..538	CDD:288708
dnj-28	NP_491084.1	TPR_11	23..89	CDD:290150
		TPR repeat	28..52	CDD:276809
		TPR_1	<31..56	CDD:278916
		TPR repeat	57..87	CDD:276809
		TPR_9	78..136	CDD:290108
		TPR repeat	92..116	CDD:276809
		TPR_11	174..240	CDD:290150
		TPR repeat	175..203	CDD:276809
		TPR repeat	208..238	CDD:276809
		TPR repeat	291..321	CDD:276809
		TPR_11	294..356	CDD:290150
		TPR repeat	326..352	CDD:276809
		DnaJ	378..>445	CDD:223560	25/64 (39%)
		DnaJ	380..445	CDD:278647	25/64 (39%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C160164694
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.930