DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsc70-5 and Ankrd45

DIOPT Version :9

Sequence 1:NP_001286414.1 Gene:Hsc70-5 / 36583 FlyBaseID:FBgn0001220 Length:686 Species:Drosophila melanogaster
Sequence 2:XP_030099044.2 Gene:Ankrd45 / 73844 MGIID:1921094 Length:313 Species:Mus musculus


Alignment Length:57 Identity:15/57 - (26%)
Similarity:30/57 - (52%) Gaps:2/57 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   579 IEIVNQGESIVHDTETKMEEFKSQLPAEECEKLKKEIADLRTLLANKETADLEEVRK 635
            :|::...|::..::..| ..|.||...||.::.::..|: ..||....|.|:|.::|
Mouse    59 LELMEPEETLESESSEK-SLFSSQQEYEESQEAEETGAE-NPLLQPTLTGDVEGLQK 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsc70-5NP_001286414.1 dnaK 51..666 CDD:234715 15/57 (26%)
HSPA9-like_NBD 51..428 CDD:212683
Syntaphilin <566..>642 CDD:291936 15/57 (26%)
Ankrd45XP_030099044.2 Ank_2 123..200 CDD:403870
ANK repeat 137..167 CDD:293786
ANK repeat 169..200 CDD:293786
PTZ00009 <246..300 CDD:240227
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.