DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsc70-5 and AgaP_AGAP004946

DIOPT Version :9

Sequence 1:NP_001286414.1 Gene:Hsc70-5 / 36583 FlyBaseID:FBgn0001220 Length:686 Species:Drosophila melanogaster
Sequence 2:XP_315044.2 Gene:AgaP_AGAP004946 / 1275758 VectorBaseID:AGAP004946 Length:1121 Species:Anopheles gambiae


Alignment Length:364 Identity:65/364 - (17%)
Similarity:120/364 - (32%) Gaps:113/364 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 IDLGTTNSCLAVM----EGKQA--KVIENAEGARTTPSHVAFTKDGERLV--GMPAKR------- 106
            :||.||...|.::    |.::|  .:...|...:.|.|..||.:.|:.::  .||.|:       
Mosquito   129 LDLVTTYVSLMILLSRVEDRKAVLGLFNAAYEMQHTQSDQAFPRLGQMIIDYDMPIKKLSEEFVP 193

  Fly   107 -----QAVTNSANTFYATKRLIGRRFDDPEV--------------KKDITNLSYKVVKASN---- 148
                 .:..||....|:.:.|...::.:.:|              |.|..:..|..::..:    
Mosquito   194 HQRLLSSAINSLTKIYSMRNLSAEKWRELQVLSLIGTPAMLLKATKTDTMSCEYISLETLDRWVI 258

  Fly   149 ----------------GDAWVSSTDGK----------VYSPSQIGAFIL----------MKMKET 177
                            .:.|:|:.|..          :|    |..:|.          .::.|.
Mosquito   259 FGLMLDHRALSQQGLVSNMWISALDSSWVVALFRDEVIY----IHQYIQTNFEGIKGYGKRISEV 319

  Fly   178 AEAYLNTPVKNAVVTVPAYFNDSQRQATKDAGQIAGLNVLRVINE-------PTAAALAYGMDKT 235
            .|.|      |..::..|..:..:|:..:.|     |..|.:|..       |.|..:..|:...
Mosquito   320 KECY------NQAISKAALLHRERRKFLRTA-----LKELALIMTDQPGLLGPKALLVFIGLCYA 373

  Fly   236 EDKII----------AVYDLGGGTFDISILEIQKGVFEVKSTNGDTLLGGEDFDNHIVNFLVAEF 290
            .|:|:          .|...|..|.|:....:.:.:|.::..........:....:.|.:|    
Mosquito   374 RDEILWLLRHNDNPPVVKSKGKSTEDLVDRHLPELLFHMEELRALVRKYSQVMQRYYVQYL---- 434

  Fly   291 KKDSGIDIRKDNIAMQRLKEAAEKAKCELSSSQQTDINL 329
               ||.|....|..||:|:...|.....|||..:|.::|
Mosquito   435 ---SGYDAIDLNYKMQQLQMCPEDESIILSSLYKTAVSL 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsc70-5NP_001286414.1 dnaK 51..666 CDD:234715 65/364 (18%)
HSPA9-like_NBD 51..428 CDD:212683 65/364 (18%)
Syntaphilin <566..>642 CDD:291936
AgaP_AGAP004946XP_315044.2 Nckap1 12..1116 CDD:286778 65/364 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D288077at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.