DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mdr50 and Abcb9

DIOPT Version :9

Sequence 1:NP_523740.3 Gene:Mdr50 / 36582 FlyBaseID:FBgn0010241 Length:1313 Species:Drosophila melanogaster
Sequence 2:NP_063928.2 Gene:Abcb9 / 56325 MGIID:1861729 Length:762 Species:Mus musculus


Alignment Length:664 Identity:211/664 - (31%)
Similarity:324/664 - (48%) Gaps:97/664 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 DRKSFEPNKSKKKSKHDESDA-SDEEDGSQYHEDVKQVSYFQLFRYATKKDRALYVIGLLSAVAT 98
            |.::.||.   .:..|.|..| :::..|:...   |.:||       ||.|.|..|         
Mouse   143 DAEALEPG---NEGFHGEGGAPAEQASGATLQ---KLLSY-------TKPDVAFLV--------- 185

  Fly    99 GLTTPANSLIFGNLANDMIDLGGLLESGKSYRADDAISTLLLDK-VRQFSLQNTYI--------- 153
                         .|:..:.:..|.|:...|....||.::::.| :.||:.....:         
Mouse   186 -------------AASFFLIVAALGETFLPYYTGRAIDSIVIQKSMDQFTTAVVVVCLLAIGSSL 237

  Fly   154 ------GIIMLVCSYLSITCFNYAAHSQILTIRSKFFRSILHQDMKWYDFNQSGEVASRMNEDLS 212
                  ||..||.:.|:|            .:|:..|||::.|:..::|.|::|::.||:..|.:
Mouse   238 AAGIRGGIFTLVFARLNI------------RLRNCLFRSLVSQETSFFDENRTGDLISRLTSDTT 290

  Fly   213 KMEDGLAEKVVMFVHYLVAFVGSLVLAFVKGWQLSLVCLTSLPLTFIAMGLVAVATSRLAKKEVT 277
            .:.|.:::.:.:|:...|...|.:|..|...||||||.....|:..:...:......||:|:..:
Mouse   291 MVSDLVSQNINIFLRNTVKVTGVVVFMFSLSWQLSLVTFMGFPIIMMVSNIYGKYYKRLSKEVQS 355

  Fly   278 MYAGAAVVAEGALSGIRTVKAFEGEAKEVAAYKERVVAAKILNIKR---NMFSGIGFGLLWFFIY 339
            ..|.|:..||..:|.::||::|..|.:|...:..::.....||.|.   .|....|.||....:.
Mouse   356 ALARASTTAEETISAMKTVRSFANEEEEAEVFLRKLQQVYKLNRKEAAAYMSYVWGSGLTLLVVQ 420

  Fly   340 ASYALAFWYGVGLVIKGYHEPAYENYDAGTMIT-VFFSVMMGSMNIGMAAPYIEAFGIAK--GAC 401
            .|   ..:||..|||.|       ...:|.:|. :.:..::|.....:.:.|   .|:.:  ||.
Mouse   421 VS---ILYYGGHLVISG-------QMSSGNLIAFIIYEFVLGDCMESVGSVY---SGLMQGVGAA 472

  Fly   402 AKVFHIIEQIP------EINPIDGEGKKLNEPLTTIEFKEVEFQYPTRPEVSILNKLNLKIHRGQ 460
            .|||..|::.|      .:.|...||:        ::|:.|.|.|.|||...:|..::..:..|:
Mouse   473 EKVFEFIDRQPTMVHDGSLAPDHLEGR--------VDFENVTFTYRTRPHTQVLQNVSFSLSPGK 529

  Fly   461 TVALVGPSGCGKSTCIQLVQRFYDPQAGNLLFNGTNLKDLDINWLRSRIGVVGQEPILFATSIYE 525
            ..|||||||.|||:|:.:::.||..|.|.:|.:|..:...|..:|...|.:|.|||:|||.||.:
Mouse   530 VTALVGPSGSGKSSCVNILENFYPLQGGRVLLDGKPIGAYDHKYLHRVISLVSQEPVLFARSITD 594

  Fly   526 NIRYGREDATREEIEAAAAAANAAIFIKKLPKGYDTLVGERGAQLSGGQKQRIAIARALIRDPEI 590
            ||.||......|.:..||..|||..||.:|..||.|..||:|||||||||||:|:||||:|:|.:
Mouse   595 NISYGLPTVPFEMVVEAAQKANAHGFIMELQDGYSTETGEKGAQLSGGQKQRVAMARALVRNPPV 659

  Fly   591 LLLDEATSALDTASEAKVQAALEKVSAGRTTIIVAHRLSTVRRADRIVVINKGEVVESGTHQELM 655
            |:|||||||||..||..:|.|:.......|.:|:|||||||.||..|||::||.||:.||||:|:
Mouse   660 LILDEATSALDAESEYLIQQAIHGNLQRHTVLIIAHRLSTVERAHLIVVLDKGRVVQQGTHQQLL 724

  Fly   656 ELKDHYFNLVTTQL 669
            .....|..||..|:
Mouse   725 AQGGLYAKLVQRQM 738

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mdr50NP_523740.3 PTZ00265 69..1308 CDD:240339 204/629 (32%)
ABC_membrane 92..382 CDD:279056 69/309 (22%)
ABC_MTABC3_MDL1_MDL2 431..668 CDD:213216 114/236 (48%)
ABC_membrane 750..1020 CDD:279056
ABC_MTABC3_MDL1_MDL2 1070..1309 CDD:213216
Abcb9NP_063928.2 3a01208 44..734 CDD:273363 208/658 (32%)
ABC_membrane 189..451 CDD:279056 67/283 (24%)
ABCC_TAP 489..714 CDD:213215 107/232 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I12044
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100059
Panther 1 1.100 - - LDO PTHR24221
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.