DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mdr50 and Tap1

DIOPT Version :9

Sequence 1:NP_523740.3 Gene:Mdr50 / 36582 FlyBaseID:FBgn0010241 Length:1313 Species:Drosophila melanogaster
Sequence 2:NP_114444.2 Gene:Tap1 / 24811 RGDID:3817 Length:725 Species:Rattus norvegicus


Alignment Length:564 Identity:183/564 - (32%)
Similarity:286/564 - (50%) Gaps:58/564 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 LLLDKVRQFSLQNTYIGIIMLVCSYLSITCFNYAA-----------HSQILTIRSKFFRSILHQD 191
            :|.||......:|.::..|:.|.|    |...:|.           ||:   :..:.||::|||:
  Rat   192 ILQDKTAPSFARNMWLMCILTVAS----TALEFAGDGIYNITMGHMHSR---VHGEVFRAVLHQE 249

  Fly   192 MKWYDFNQSGEVASRMNEDLSKMEDGLAEKVVMFVHYLVAFVGSLVLAFV--KGWQLSLVCLTSL 254
            ..::..|.:|.:.||:.||.|.:.:.:::|:.:|:.||..  |..:|||:  ..:.|::|.|.||
  Rat   250 TGFFLKNPTGSITSRVTEDTSNVCESISDKLNLFLWYLGR--GLCLLAFMIWGSFYLTVVTLLSL 312

  Fly   255 PLTFIAMGLVAVATSRLAKKEVTMYAGAAVVAEGALSGIRTVKAFEGEAKEVAAYKERVVAAKIL 319
            ||.|:....:......||.|.....|.:..||..|||.:.||::|..|..|...:::::...|.|
  Rat   313 PLLFLLPRRLGKVYQSLAVKVQESLAKSTQVALEALSAMPTVRSFANEEGEAQKFRQKLEEMKPL 377

  Fly   320 NIKRNM----------FSG--IGFGLLWFFIYASYALAFWYGVGLVIKGYHEPAYENYDAGTMIT 372
            |.|..:          .||  :..|:|:.            |..||::|       ...:|.:::
  Rat   378 NKKEALAYVTEVWTMSVSGMLLKVGILYL------------GGQLVVRG-------AVSSGNLVS 423

  Fly   373 VFFSVMMGSMNIGMAAPYIEAFGIAKGACAKVFHIIEQIPEINPIDGEGKKLNEPLTTIEFKEVE 437
            .....:..:..:.:......:...:.||..|:|..:::.| .:|:.|....||.. ..::|::|.
  Rat   424 FVLYQLQFTRAVEVLLSIYPSMQKSVGASEKIFEYLDRTP-CSPLSGSLAPLNMK-GLVKFQDVS 486

  Fly   438 FQYPTRPEVSILNKLNLKIHRGQTVALVGPSGCGKSTCIQLVQRFYDPQAGNLLFNGTNLKDLDI 502
            |.||..|.|.:|..|...::.|:..|||||:|.||||...|:|..|.|..|.:|.:|..|...|.
  Rat   487 FAYPNHPNVQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGELLVQYDH 551

  Fly   503 NWLRSRIGVVGQEPILFATSIYENIRYG-REDATREEIEAAAAAANAAIFIKKLPKGYDTLVGER 566
            ::|.:::..|||||:||..|..|||.|| ....|.|||.|.|..:.|..||...|:||||.|||.
  Rat   552 HYLHTQVAAVGQEPLLFGRSFRENIAYGLTRTPTMEEITAVAMESGAHDFISGFPQGYDTEVGET 616

  Fly   567 GAQLSGGQKQRIAIARALIRDPEILLLDEATSALDTASEAKVQAALEKVS--AGRTTIIVAHRLS 629
            |.||||||:|.:|:||||||.|.:|:||:||||||..::.:||..|.:..  |.||.:::..:||
  Rat   617 GNQLSGGQRQAVALARALIRKPRLLILDDATSALDAGNQLRVQRLLYESPEWASRTVLLITQQLS 681

  Fly   630 TVRRADRIVVINKGEVVESGTHQELMELKDHYFNLVTTQLGEDD 673
            ...||..|:.:.:|.|.|.|||.:|||....|.::|.......|
  Rat   682 LAERAHHILFLKEGSVCEQGTHLQLMERGGCYRSMVEALAAPSD 725

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mdr50NP_523740.3 PTZ00265 69..1308 CDD:240339 183/564 (32%)
ABC_membrane 92..382 CDD:279056 66/268 (25%)
ABC_MTABC3_MDL1_MDL2 431..668 CDD:213216 107/239 (45%)
ABC_membrane 750..1020 CDD:279056
ABC_MTABC3_MDL1_MDL2 1070..1309 CDD:213216
Tap1NP_114444.2 3a01208 2..717 CDD:273363 181/554 (33%)
ABC_membrane 177..435 CDD:279056 66/270 (24%)
Part of the peptide-binding site. /evidence=ECO:0000250|UniProtKB:Q03518 352..397 10/44 (23%)
Part of the peptide-binding site. /evidence=ECO:0000250|UniProtKB:Q03518 430..464 5/34 (15%)
P-loop_NTPase 469..697 CDD:304359 100/228 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24221
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.