DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mdr50 and LOC101883977

DIOPT Version :9

Sequence 1:NP_523740.3 Gene:Mdr50 / 36582 FlyBaseID:FBgn0010241 Length:1313 Species:Drosophila melanogaster
Sequence 2:XP_005174513.2 Gene:LOC101883977 / 101883977 -ID:- Length:257 Species:Danio rerio


Alignment Length:244 Identity:77/244 - (31%)
Similarity:132/244 - (54%) Gaps:21/244 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 LYVIGLLSAVATGLTTPANSLIFGNLANDM----IDLGGLLESGKS--------------YRADD 133
            :.|:|...::..|..||...|::|.:.|..    :::..|.:..|:              .|.|:
Zfish     1 MMVVGSFCSLVHGAATPLMLLVYGMMTNTFVEYEVEILELTDPNKTCINNTISWMNGSAVQRPDN 65

  Fly   134 AISTLLLD---KVRQFSLQNTYIGIIMLVCSYLSITCFNYAAHSQILTIRSKFFRSILHQDMKWY 195
            ......:|   ::..|:|....||:.:|:.|:..||.:..||..||..||..:||.|:..::.|:
Zfish    66 TTIYCGVDIEAEMTNFALYYIGIGVGVLILSFFQITFWVSAAARQIQRIRKTYFRKIMRMEIGWF 130

  Fly   196 DFNQSGEVASRMNEDLSKMEDGLAEKVVMFVHYLVAFVGSLVLAFVKGWQLSLVCLTSLPLTFIA 260
            |.|..||:.:||::|::|:.:.:|::|.:|:..:..|:...::.|:.||:|:||.:...||..:|
Zfish   131 DCNSVGELNTRMSDDINKINNAIADQVSIFIERISTFIFGFMVGFIGGWKLTLVVIAVSPLLGLA 195

  Fly   261 MGLVAVATSRLAKKEVTMYAGAAVVAEGALSGIRTVKAFEGEAKEVAAY 309
            .||:|:|.:||..:|:..||.|..||:..||.||||.||.||.||...|
Zfish   196 AGLMAMAVARLTGRELKAYAKAGAVADEVLSSIRTVAAFGGEHKEAERY 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mdr50NP_523740.3 PTZ00265 69..1308 CDD:240339 77/244 (32%)
ABC_membrane 92..382 CDD:279056 75/239 (31%)
ABC_MTABC3_MDL1_MDL2 431..668 CDD:213216
ABC_membrane 750..1020 CDD:279056
ABC_MTABC3_MDL1_MDL2 1070..1309 CDD:213216
LOC101883977XP_005174513.2 ABC_membrane 76..>244 CDD:279056 63/167 (38%)
MdlB 80..>255 CDD:224055 64/165 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D186078at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.