DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmydA-1 and SET5

DIOPT Version :9

Sequence 1:NP_610944.1 Gene:SmydA-1 / 36581 FlyBaseID:FBgn0033917 Length:513 Species:Drosophila melanogaster
Sequence 2:NP_012077.1 Gene:SET5 / 856614 SGDID:S000001250 Length:526 Species:Saccharomyces cerevisiae


Alignment Length:329 Identity:68/329 - (20%)
Similarity:112/329 - (34%) Gaps:80/329 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 NEQLGRHLVATRTIKPYEIVLKE-APLVRGPAQ------ISAPVCLGCLNGI-EAEDH------I 98
            :::.||.|.|.|.....:|:||| .|:|..|..      .:...|..|...: :...|      :
Yeast   120 DDEHGRGLFAKRDFSKGQIILKENKPIVYIPPLDKLFLISNGKACARCGKALYDLTQHKIMVHYL 184

  Fly    99 ECEQCGWPLCGPECKSLDEHKAECGLTKDRGQKVNVQEFGG--------PHPLYTCLSTVRCL-- 153
            :||.|....|..:||.......|......|..::::...|.        ....:|...:|..:  
Yeast   185 DCEVCKAIWCSEKCKKAHASLHELLYHSWRSNRIDILHAGNWKRFVNYCEKYCFTAAFSVGLIYG 249

  Fly   154 -LIGETSTEKASKFQDLESLESTRRGSNQWKADLVSIGQFIPKFFKTQKFTEEE----------- 206
             ::.:|:.|...::|.|.|:....|...:   |...||........|...||||           
Yeast   250 SMLLDTTGEVKEQWQKLASISQRERIKLR---DASGIGSTFSLLNGTTVHTEEESDNGTKKGVEK 311

  Fly   207 ------------------------------IMKAVGALQINGHEVPTTDPSHVAVFYTASFTENS 241
                                          .:..:|...||.:        :..|::..||..:.
Yeast   312 NIDDETVWEKCYELFCGAFPKASEEIDFEKFLTMIGTFNINQY--------NGQVYHWISFINHD 368

  Fly   242 CLPN-LAKSFNKNGHCILWAPREIKKNAHLSICYSDAMWGTADRQRHLMQTKLFKCACERCVDVT 305
            |.|| ..:...::....|.|.:.|||...:.|.|.:.:.|...|:|.|.....|.|.|:||.:  
Yeast   369 CEPNAYIEQVEEHEELRLHARKPIKKGEQIRITYVNPLHGVRLRRRELRVNWGFLCQCDRCQN-- 431

  Fly   306 ELDT 309
            ||.|
Yeast   432 ELST 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmydA-1NP_610944.1 zf-MYND 4..40 CDD:280009
SET5NP_012077.1 SET 41..526 CDD:225491 68/329 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4564
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.760

Return to query results.
Submit another query.