powered by:
Protein Alignment SmydA-1 and SET6
DIOPT Version :9
Sequence 1: | NP_610944.1 |
Gene: | SmydA-1 / 36581 |
FlyBaseID: | FBgn0033917 |
Length: | 513 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_015160.1 |
Gene: | SET6 / 855938 |
SGDID: | S000006086 |
Length: | 373 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 72 |
Identity: | 27/72 - (37%) |
Similarity: | 38/72 - (52%) |
Gaps: | 2/72 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 231 VFYTASFTENSCLPNLAKSFNKNGHCILWAPREIKKNAHLSICYSDAM-WGTADRQRHLMQTKLF 294
||..||:..:||.||:.| :.|....:....|:|||:..:.|.||..: ..|..|:..|..:..|
Yeast 295 VFPEASYFNHSCNPNITK-YRKGNSMLFTMNRDIKKDEQICIDYSGVLDLPTVKRRAFLADSWFF 358
Fly 295 KCACERC 301
.||||||
Yeast 359 DCACERC 365
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
SmydA-1 | NP_610944.1 |
zf-MYND |
4..40 |
CDD:280009 |
|
SET6 | NP_015160.1 |
SET |
<1..370 |
CDD:225491 |
27/72 (38%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E2759_KOG2084 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
1 |
0.950 |
- |
0 |
Normalized mean entropy |
S4564 |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.850 |
|
Return to query results.
Submit another query.