DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmydA-1 and SET6

DIOPT Version :9

Sequence 1:NP_610944.1 Gene:SmydA-1 / 36581 FlyBaseID:FBgn0033917 Length:513 Species:Drosophila melanogaster
Sequence 2:NP_015160.1 Gene:SET6 / 855938 SGDID:S000006086 Length:373 Species:Saccharomyces cerevisiae


Alignment Length:72 Identity:27/72 - (37%)
Similarity:38/72 - (52%) Gaps:2/72 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   231 VFYTASFTENSCLPNLAKSFNKNGHCILWAPREIKKNAHLSICYSDAM-WGTADRQRHLMQTKLF 294
            ||..||:..:||.||:.| :.|....:....|:|||:..:.|.||..: ..|..|:..|..:..|
Yeast   295 VFPEASYFNHSCNPNITK-YRKGNSMLFTMNRDIKKDEQICIDYSGVLDLPTVKRRAFLADSWFF 358

  Fly   295 KCACERC 301
            .||||||
Yeast   359 DCACERC 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmydA-1NP_610944.1 zf-MYND 4..40 CDD:280009
SET6NP_015160.1 SET <1..370 CDD:225491 27/72 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4564
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.850

Return to query results.
Submit another query.