DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmydA-1 and ATXR2

DIOPT Version :10

Sequence 1:NP_610944.1 Gene:SmydA-1 / 36581 FlyBaseID:FBgn0033917 Length:513 Species:Drosophila melanogaster
Sequence 2:NP_188819.2 Gene:ATXR2 / 821736 AraportID:AT3G21820 Length:473 Species:Arabidopsis thaliana


Alignment Length:60 Identity:14/60 - (23%)
Similarity:20/60 - (33%) Gaps:4/60 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 VEELANHRYMDLELAERLDESTAANRTEVLEAIVREYSNRLCETECYEKF----ISKLVE 149
            :|.|....|..|......|.....|....|..||....:.:..|.|..:|    :|.:.|
plant    23 IERLKTPMYYFLSHLSLCDILLTTNIVPKLLDIVLTTKDSISITGCLTQFYFFGVSTVTE 82

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmydA-1NP_610944.1 zf-MYND 4..40 CDD:460312
SET_SMYD <217..301 CDD:380997
ATXR2NP_188819.2 zf-MYND <173..203 CDD:460312
SET_SMYD <380..466 CDD:380997
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.