DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmydA-1 and ASHR2

DIOPT Version :9

Sequence 1:NP_610944.1 Gene:SmydA-1 / 36581 FlyBaseID:FBgn0033917 Length:513 Species:Drosophila melanogaster
Sequence 2:NP_849991.1 Gene:ASHR2 / 816483 AraportID:AT2G19640 Length:398 Species:Arabidopsis thaliana


Alignment Length:393 Identity:77/393 - (19%)
Similarity:130/393 - (33%) Gaps:130/393 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 GRHLVATRTIKPYEIVLKEAPLVRGPA-----QISAPVCLGCLNGIEAEDHIECEQCGW-PLCGP 110
            ||.|||.::::..:::|:|:||:...|     ...:|.|..|...:.:..|.:|:.|.. ..|.|
plant    22 GRSLVAAQSLRAGQVILRESPLLLYSAFPFLSSSVSPYCDHCFRLLASSAHQKCQSCSLVSFCSP 86

  Fly   111 E---------CKSLDE-HKAECGLTKDRGQKVNVQEFGGPHPLYTCLSTVRCLLIG-ETSTEKAS 164
            .         |:||.. |::......|:.....||              .|.||.. ..:....|
plant    87 NCFASHTPWLCESLRRLHQSSSSAFSDQPSDRQVQ--------------ARFLLSAYNLAAASPS 137

  Fly   165 KFQDLESLESTRRGSNQWKAD-----------------LVSIGQFIPKFFK---TQKFTEEEIMK 209
            .||.|.||:    ||.....|                 |.|:...:|....   |.....::.:.
plant   138 DFQILLSLQ----GSGSSNGDPSCSAGDSAAAGFLHSLLSSVCPSLPVSISPDLTAALLSKDKVN 198

  Fly   210 AVGALQINGHEVPTTDPSHVA----------VFYTASFTENSCLPNLAK------SFNKNGHCIL 258
            |.|.:          :|..|:          ::...||..:.||||..:      :.:.|...|:
plant   199 AFGLM----------EPCSVSNEKRSVRAYGIYPKTSFFNHDCLPNACRFDYVDSASDGNTDIII 253

  Fly   259 WAPREIKKNAHLSICYSDAMWGTADRQRHLMQTKLFKCACERC-VDVT----ELDTN-------- 310
            ....::.:...:.:.|.......:.||:.|::...|||.|:|| |:.:    |.|.|        
plant   254 RMIHDVPEGREVCLSYFPVNMNYSSRQKRLLEDYGFKCDCDRCKVEFSWSEGEEDENEIMEEMED 318

  Fly   311 --------------------------------YSAIK--CEDRQCGGLM--LPTKADEWNGSWRC 339
                                            |..::  ||...|.|.:  ||.|..:.:....|
plant   319 QDEQEEMEDSVGENEEEVCGNGVDDESNFPHAYFFVRYMCEKENCFGTLAPLPPKTHDASRVLEC 383

  Fly   340 REC 342
            ..|
plant   384 NVC 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmydA-1NP_610944.1 zf-MYND 4..40 CDD:280009
ASHR2NP_849991.1 SET <192..275 CDD:214614 13/92 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D981799at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.